SitesBLAST
Comparing Ac3H11_3411 FitnessBrowser__acidovorax_3H11:Ac3H11_3411 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O70351 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Rattus norvegicus (Rat) (see paper)
51% identity, 99% coverage: 3:253/254 of query aligns to 8:261/261 of O70351
- S155 (= S147) binding
- Y168 (= Y160) active site, Proton acceptor
1e3wD Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and 3-keto butyrate (see paper)
51% identity, 99% coverage: 3:253/254 of query aligns to 2:255/255 of 1e3wD
- active site: G15 (= G16), N115 (= N113), T147 (= T145), S149 (= S147), Y162 (= Y160), K166 (= K164), F195 (= F193)
- binding acetoacetic acid: Y162 (= Y160), T202 (≠ E200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), L16 (= L17), D35 (= D36), V36 (≠ R37), N58 (≠ D57), V59 (≠ I58), C85 (≠ V84), A86 (= A85), G87 (= G86), V114 (≠ I112), T147 (= T145), Y162 (= Y160), K166 (= K164), P192 (= P190), L194 (= L192), F195 (= F193), T197 (= T195), L199 (= L197)
O18404 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxyacyl-CoA dehydrogenase type II; Hydroxysteroid dehydrogenase; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.62; EC 1.1.1.-; EC 1.1.1.53 from Drosophila melanogaster (Fruit fly) (see paper)
51% identity, 99% coverage: 3:253/254 of query aligns to 2:255/255 of O18404
- L33 (≠ V34) mutation to Q: Lethal allele.
- F120 (≠ Y118) mutation to I: Lethal allele.
4xgnA Crystal structure of 3-hydroxyacyl-coa dehydrogenase in complex with NAD from burkholderia thailandensis
52% identity, 100% coverage: 1:254/254 of query aligns to 4:255/255 of 4xgnA
- active site: Y161 (= Y160), K165 (= K164)
- binding nicotinamide-adenine-dinucleotide: G15 (= G12), S18 (= S15), G19 (= G16), L20 (= L17), D39 (= D36), L40 (≠ R37), C59 (= C56), D60 (= D57), V61 (≠ I58), C86 (≠ V84), A87 (= A85), V113 (≠ I112), T146 (= T145), Y161 (= Y160), K165 (= K164), P191 (= P190), I193 (≠ L192), F194 (= F193), T196 (= T195), M198 (≠ L197)
4o5oB X-ray crystal structure of a 3-hydroxyacyl-coa dehydrogenase from brucella suis
53% identity, 100% coverage: 1:254/254 of query aligns to 7:261/261 of 4o5oB
Sites not aligning to the query:
1u7tA Crystal structure of abad/hsd10 with a bound inhibitor (see paper)
50% identity, 99% coverage: 3:253/254 of query aligns to 2:255/255 of 1u7tA
- active site: G15 (= G16), N115 (= N113), T147 (= T145), S149 (= S147), Y162 (= Y160), K166 (= K164), F195 (= F193)
- binding 1-azepan-1-yl-2-phenyl-2-(4-thioxo-1,4-dihydro-pyrazolo[3,4-d]pyrimidin-5-yl)ethanone adduct: G11 (= G12), S14 (= S15), G15 (= G16), L16 (= L17), D35 (= D36), L36 (≠ R37), D58 (= D57), V59 (≠ I58), C85 (≠ V84), A86 (= A85), G87 (= G86), A89 (≠ G88), V90 (≠ S89), A91 (= A90), T147 (= T145), S149 (= S147), Q156 (= Q154), Q159 (= Q157), Y162 (= Y160), K166 (= K164), P192 (= P190), L194 (= L192), F195 (= F193), T197 (= T195), L199 (= L197), L200 (≠ M198), L203 (= L201)
O08756 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Mus musculus (Mouse)
51% identity, 99% coverage: 3:253/254 of query aligns to 8:261/261 of O08756
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
7onuC Structure of human mitochondrial rnase p in complex with mitochondrial pre-tRNA-tyr (see paper)
50% identity, 99% coverage: 3:253/254 of query aligns to 2:255/255 of 7onuC
- binding nicotinamide-adenine-dinucleotide: S14 (= S15), G15 (= G16), L16 (= L17), D35 (= D36), L36 (≠ R37), V59 (≠ I58), C85 (≠ V84), S149 (= S147), Y162 (= Y160), F195 (= F193), T197 (= T195)
- binding : S92 (≠ K91), K93 (≠ R92)
Q99714 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Homo sapiens (Human) (see 14 papers)
50% identity, 99% coverage: 3:253/254 of query aligns to 8:261/261 of Q99714
- V12 (≠ A7) to L: in HSD10MD; decreased dehydrogenase activity; decreased tRNA methylation; decreased mitochondrial tRNA 5'-end processing
- S20 (= S15) binding ; mutation to F: Decreased dehydrogenase activity. Does not affect mitochondrial tRNA 5'-end processing. Does not affect tRNA methylation.
- L22 (= L17) binding
- D41 (= D36) binding
- D64 (= D57) binding
- V65 (≠ I58) binding ; to A: in HSD10MD; uncertain significance; dbSNP:rs104886492
- D86 (≠ R79) to G: in HSD10MD; decreased 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; no effect on NAD(+) binding; complete loss of phospholipase C-like activity toward cardiolipin; dbSNP:rs587777651
- C91 (≠ V84) binding
- R130 (= R122) to C: in HSD10MD; decreased stability; decreased 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; decreased mitochondrial tRNA 5'-end processing; decreased tRNA methylation; does not affect homotetramerization; complete loss of phospholipase C-like activity toward cardiolipin; dbSNP:rs28935475
- S155 (= S147) binding
- Q165 (= Q157) to H: in HSD10MD; loss of 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; does not bind NAD(+); complete loss of phospholipase C-like activity toward cardiolipin
- Y168 (= Y160) active site, Proton acceptor; binding
- K172 (= K164) binding ; mutation to A: Abolishes dehydrogenase activity. Does not affect mitochondrial tRNA 5'-end processing. Does not affect tRNA methylation. Does not affect homotetramerization.
- V176 (≠ A168) to M: in HSD10MD; decreased dehydrogenase activity; strongly decreased tRNA methylation; strongly decreased mitochondrial tRNA 5'-end processing
- F201 (= F193) binding
- T203 (= T195) binding
- P210 (= P202) to S: in HSD10MD; decreased 3-hydroxyacyl-CoA dehydrogenase activity; decreased mitochondrial tRNA 5'-end processing; decreased tRNA methylation; does not affect homotetramerization
- K212 (≠ A204) to E: in HSD10MD; 4-fold decrease of 3-hydroxyacyl-CoA dehydrogenase activity; decreased interaction with TRMT10C; decreased function in mitochondrial tRNA methylation; decreased function in mitochondrial tRNA processing; dbSNP:rs886041974
- R226 (= R218) to Q: in HSD10MD; strongly decreased 3-hydroxyacyl-CoA dehydrogenase activity; abolished mitochondrial tRNA 5'-end processing; abolished tRNA methylation; impaired homotetramerization; dbSNP:rs1556894502
- N247 (= N239) to S: in HSD10MD; strongly decreased 3-hydroxyacyl-CoA dehydrogenase activity; abolished mitochondrial tRNA 5'-end processing; abolished tRNA methylation; impaired homotetramerization; dbSNP:rs122461163
- E249 (= E241) to Q: in HSD10MD; decreased 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; dbSNP:rs62626305
6ujkA Crystal structure of a probable short-chain type dehydrogenase/reductase (rv1144) from mycobacterium tuberculosis with bound NAD
52% identity, 100% coverage: 1:254/254 of query aligns to 2:246/246 of 6ujkA
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), S16 (= S15), G17 (= G16), L18 (= L17), D37 (= D36), L38 (≠ R37), D57 (= D57), V58 (≠ I58), C83 (≠ V84), A84 (= A85), T142 (= T145), S144 (= S147), Y157 (= Y160), K161 (= K164), G188 (= G191), F190 (= F193), T192 (= T195), L194 (= L197)
1e6wC Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol (see paper)
50% identity, 99% coverage: 3:253/254 of query aligns to 2:248/248 of 1e6wC
- active site: G15 (= G16), N115 (= N113), T147 (= T145), S149 (= S147), Y162 (= Y160), K166 (= K164), F195 (= F193)
- binding estradiol: Q159 (= Q157), Y162 (= Y160), L200 (≠ M198)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), L16 (= L17), D35 (= D36), V36 (≠ R37), N58 (≠ D57), V59 (≠ I58), C85 (≠ V84), A86 (= A85), T147 (= T145), Y162 (= Y160), K166 (= K164), P192 (= P190), L194 (= L192), F195 (= F193), T197 (= T195), L199 (= L197)
3ppiA Crystal structure of 3-hydroxyacyl-coa dehydrogenase type-2 from mycobacterium avium (see paper)
46% identity, 100% coverage: 2:254/254 of query aligns to 4:258/258 of 3ppiA
2o23B The structure of wild-type human hadh2 (17beta-hydroxysteroid dehydrogenase type 10) bound to NAD+ at 1.2 a
49% identity, 99% coverage: 3:253/254 of query aligns to 8:253/255 of 2o23B
- active site: G21 (= G16), N121 (= N113), T153 (= T145), S155 (= S147), Y168 (= Y160), K172 (= K164), F201 (= F193)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), S20 (= S15), G21 (= G16), L22 (= L17), D41 (= D36), L42 (≠ R37), D64 (= D57), V65 (≠ I58), C91 (≠ V84), A92 (= A85), T153 (= T145), Y168 (= Y160), K172 (= K164), P198 (= P190), L200 (= L192), F201 (= F193), T203 (= T195), L205 (= L197)
1uayA Crystal structure of type ii 3-hydroxyacyl-coa dehydrogenase from thermus thermophilus hb8
52% identity, 98% coverage: 6:254/254 of query aligns to 2:241/241 of 1uayA
- active site: G12 (= G16), S134 (= S147), Y147 (= Y160), K151 (= K164)
- binding adenosine: G8 (= G12), S11 (= S15), D32 (= D36), L33 (≠ R37), D46 (= D57), V47 (≠ I58), A73 (= A85), G74 (= G86)
7n09A Structural basis for branched substrate selectivity in a ketoreductase from ascaris suum
43% identity, 98% coverage: 4:251/254 of query aligns to 7:257/259 of 7n09A
- binding nicotinamide-adenine-dinucleotide: G15 (= G12), S18 (= S15), G19 (= G16), L20 (= L17), D39 (= D36), L40 (≠ R37), S62 (≠ D57), V63 (≠ I58), C89 (≠ V84), A90 (= A85), S153 (= S147), Y166 (= Y160), K170 (= K164), P196 (= P190), G197 (= G191), I198 (≠ L192), F199 (= F193), T201 (= T195), M203 (≠ L197)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 98% coverage: 2:251/254 of query aligns to 4:244/244 of 4nbuB
- active site: G18 (= G16), N111 (= N113), S139 (= S147), Q149 (= Q157), Y152 (= Y160), K156 (= K164)
- binding acetoacetyl-coenzyme a: D93 (= D97), K98 (≠ A100), S139 (= S147), N146 (≠ Q154), V147 (= V155), Q149 (= Q157), Y152 (= Y160), F184 (≠ L192), M189 (≠ L197), K200 (≠ S208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (≠ L17), D38 (= D36), F39 (≠ R37), V59 (≠ C56), D60 (= D57), V61 (≠ I58), N87 (≠ V84), A88 (= A85), G89 (= G86), I90 (= I87), T137 (= T145), S139 (= S147), Y152 (= Y160), K156 (= K164), P182 (= P190), F184 (≠ L192), T185 (≠ F193), T187 (= T195), M189 (≠ L197)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
32% identity, 98% coverage: 1:249/254 of query aligns to 4:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G12), R18 (≠ S15), G19 (= G16), I20 (≠ L17), D39 (= D36), R40 (= R37), C63 (= C56), I65 (= I58), N91 (≠ V84), G93 (= G86), I94 (= I87), V114 (≠ I112), Y155 (= Y160), K159 (= K164), I188 (≠ F193), T190 (= T195), T193 (≠ M198)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
31% identity, 98% coverage: 2:251/254 of query aligns to 2:239/239 of 4nbtA
- active site: G16 (= G16), S132 (≠ A146), Y145 (= Y160), K149 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), K15 (≠ S15), G16 (= G16), L17 (= L17), D36 (= D36), L37 (= L41), L52 (≠ C56), N53 (≠ D57), V54 (≠ I58), N80 (≠ V84), A81 (= A85), G82 (= G86), I130 (≠ F144), S132 (≠ A146), Y145 (= Y160), K149 (= K164), P177 (= P190), G178 (= G191), I180 (≠ F193), T182 (= T195)
Q8N4T8 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit; KAR beta subunit; Carbonyl reductase family member 4; CBR4; Quinone reductase CBR4; Short chain dehydrogenase/reductase family 45C member 1; EC 1.1.1.100; EC 1.6.5.10 from Homo sapiens (Human) (see 4 papers)
33% identity, 95% coverage: 10:251/254 of query aligns to 7:235/237 of Q8N4T8
- G9 (= G12) mutation to S: Unable to restore growth of an OAR1-deficient yeast mutant.
- SRGI 11:14 (≠ ASGL 14:17) binding
- R12 (≠ S15) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant.
- R34 (= R37) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Strongly reduces NADPH-dependent reductase activity with acetoacetyl-CoA and 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- RN 34:35 (= RN 37:38) binding
- D56 (= D57) binding
- L70 (≠ A71) to M: in dbSNP:rs2877380
- AAG 83:85 (≠ VAG 84:86) binding
- S135 (= S147) mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- Y148 (= Y160) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- K152 (= K164) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant. Abolishes NADPH-dependent reductase activity with acetoacetyl-CoA. Strongly reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- R168 (≠ Q180) mutation to E: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- K169 (≠ H181) mutation to E: Unable to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- VHT 181:183 (≠ FAT 193:195) binding
4cqmF Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
33% identity, 95% coverage: 10:251/254 of query aligns to 11:239/241 of 4cqmF
- active site: G17 (= G16), S139 (= S147), Q149 (= Q157), Y152 (= Y160), K156 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), R16 (≠ S15), G17 (= G16), I18 (≠ L17), A37 (≠ D36), R38 (= R37), N39 (= N38), D60 (= D57), V61 (≠ I58), A87 (≠ V84), A88 (= A85), G89 (= G86), V137 (≠ T145), S139 (= S147), Y152 (= Y160), K156 (= K164), V185 (≠ F193), T187 (= T195), M189 (≠ L197)
Query Sequence
>Ac3H11_3411 FitnessBrowser__acidovorax_3H11:Ac3H11_3411
MQIQGQAALVTGGASGLGEATARALAAQGAKVAVLDRNAELAEKVAADINGIACPCDITD
PASVQAAIDKAAAAHGPARILMNVAGIGSAKRVVQRDGSAAPLEDFVRVVNINLIGTYNV
SRLFAAACSKLDVLDNGERGVMMFTASVAAFDGQVGQQAYSASKAGLAGMTLPMARDLAQ
HAIRVCTVAPGLFATPLMKELPEAVQQSLAASIPFPPRLGKPEEFAELACHIVTNGHLNG
EVIRLDGALRMAPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory