SitesBLAST
Comparing Ac3H11_3427 FitnessBrowser__acidovorax_3H11:Ac3H11_3427 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
43% identity, 34% coverage: 814:1238/1243 of query aligns to 2:429/440 of 8gy3A
- binding heme c: Y52 (≠ D863), C53 (= C864), C56 (= C867), H57 (= H868), S84 (≠ T892), I86 (≠ L894), W97 (= W905), F102 (= F910), L117 (= L925), F121 (= F929), F126 (= F934), R163 (= R971), C203 (= C1010), C206 (= C1013), H207 (= H1014), A232 (= A1040), P233 (= P1041), L235 (= L1043), W245 (= W1053), Y253 (= Y1061), L254 (= L1062), G263 (= G1071), S264 (= S1072), M269 (= M1077), Y292 (≠ L1099), C337 (= C1144), C340 (= C1147), H341 (= H1148), P353 (≠ V1161), L355 (= L1163), N358 (= N1166), N359 (≠ S1167), V372 (= V1180), I377 (= I1185), G382 (≠ A1190), Q383 (≠ R1191), I386 (≠ G1194), M388 (= M1196), F391 (= F1199)
- binding ubiquinone-10: E55 (≠ V866), T76 (= T884), F78 (= F886), Y118 (= Y926), P119 (= P927), I160 (≠ F968), G166 (≠ M974), Q167 (≠ A975), F169 (vs. gap), W170 (= W977), H202 (= H1009), R210 (= R1017), L213 (= L1020)
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
36% identity, 31% coverage: 852:1239/1243 of query aligns to 1:388/418 of 7w2jC
- binding heme c: C13 (= C864), C16 (= C867), H17 (= H868), T42 (= T892), I44 (≠ L894), Y55 (≠ W905), L75 (= L925), Y76 (= Y926), A78 (= A928), M79 (≠ F929), R122 (= R971), H161 (= H1009), C162 (= C1010), C165 (= C1013), H166 (= H1014), A191 (= A1040), P192 (= P1041), R223 (≠ S1072), P227 (= P1076), M228 (= M1077), V289 (≠ A1143), C290 (= C1144), C293 (= C1147), H294 (= H1148), Y305 (≠ V1159), Y306 (≠ N1160), P307 (≠ V1161), L309 (= L1163), N312 (= N1166), T313 (≠ S1167), T314 (≠ N1168), D322 (≠ N1176), I327 (= I1181), V331 (≠ I1185), R333 (≠ E1187), I340 (≠ G1194), M342 (= M1196), P343 (= P1197), F345 (= F1199)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
36% identity, 31% coverage: 852:1239/1243 of query aligns to 1:402/413 of 8jejC
- binding heme c: C13 (= C864), C16 (= C867), H17 (= H868), T42 (= T892), I44 (≠ L894), F60 (= F910), L64 (≠ M914), L75 (= L925), Y76 (= Y926), M79 (≠ F929), P80 (= P930), Y84 (≠ F934), R122 (= R971), C162 (= C1010), C165 (= C1013), H166 (= H1014), I186 (= I1035), W189 (= W1038), A191 (= A1040), P192 (= P1041), I194 (≠ L1043), W205 (= W1053), Y213 (= Y1061), R223 (≠ S1072), M228 (= M1077), V303 (≠ A1143), C304 (= C1144), C307 (= C1147), H308 (= H1148), Y320 (≠ N1160), P321 (≠ V1161), L323 (= L1163), T327 (≠ S1167), T328 (≠ N1168), D336 (≠ N1176), I341 (= I1181), V345 (≠ I1185), R347 (≠ E1187), I354 (≠ G1194), M356 (= M1196), F359 (= F1199), I376 (≠ L1211)
- binding ubiquinone-10: M36 (≠ F886), P77 (= P927), S124 (≠ L973), W128 (= W977), C165 (= C1013), L173 (≠ G1021)
Sites not aligning to the query:
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
37% identity, 31% coverage: 848:1229/1243 of query aligns to 40:430/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
37% identity, 31% coverage: 848:1229/1243 of query aligns to 2:392/433 of 8gy2B
- binding heme c: C18 (= C864), C21 (= C867), H22 (= H868), T46 (= T892), I48 (≠ L894), Y59 (≠ W905), L68 (≠ M914), R73 (≠ S919), V79 (≠ L925), Y80 (= Y926), M83 (≠ F929), F88 (= F934), R126 (= R971), H165 (= H1009), C166 (= C1010), C169 (= C1013), H170 (= H1014), I201 (≠ E1039), A202 (= A1040), P203 (= P1041), L205 (= L1043), W216 (= W1053), F224 (≠ Y1061), A234 (≠ S1072), V235 (≠ A1073), F236 (≠ S1074), F236 (≠ S1074), M239 (= M1077), N301 (≠ A1143), C302 (= C1144), C305 (= C1147), H306 (= H1148), M316 (≠ V1159), F317 (≠ N1160), P318 (≠ V1161), L320 (= L1163), P324 (≠ S1167), G342 (≠ I1185), S352 (≠ D1192), V354 (≠ G1194), M356 (= M1196), F359 (= F1199), M375 (= M1215)
- binding ubiquinone-10: C21 (= C867), L34 (≠ R880), P39 (= P885), P81 (= P927), L129 (≠ M974), W132 (= W977), E168 (≠ A1012), R173 (= R1017), I197 (= I1035), D241 (≠ P1079)
Sites not aligning to the query:
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
28% identity, 57% coverage: 54:765/1243 of query aligns to 18:728/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (≠ L74), G39 (= G75), Q40 (≠ T76), H41 (≠ G77), V42 (≠ I78), A45 (= A81), G79 (≠ I114), G80 (≠ A115), S81 (= S116), S83 (= S118), V84 (≠ I119), G374 (≠ C415), F375 (≠ Y416), L379 (≠ G420), L499 (= L536), R500 (= R537), V624 (= V658), D625 (≠ N659), Q632 (= Q666), T687 (≠ L724), G688 (= G725), L689 (≠ S726), G690 (= G727), E691 (= E728)
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
38% identity, 10% coverage: 56:176/1243 of query aligns to 27:147/330 of 3hrdB
Sites not aligning to the query:
- active site: 289, 290
- binding pterin cytosine dinucleotide: 215, 216, 219, 220, 223, 285, 286, 287, 288, 289
- binding nicotinic acid: 17, 18
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
38% identity, 10% coverage: 56:176/1243 of query aligns to 27:147/330 of Q0QLF1
Sites not aligning to the query:
- 211:223 binding
- 284:289 binding
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 30% coverage: 195:568/1243 of query aligns to 3:381/420 of 3hrdE
- active site: Q207 (= Q385), L242 (≠ G420), R318 (= R495), H322 (≠ Y504), R350 (= R537)
- binding calcium ion: T206 (= T384), N208 (= N386), D212 (≠ L390), K241 (≠ N419), L242 (≠ G420), D243 (≠ A421)
- binding pterin cytosine dinucleotide: G237 (≠ C415), F238 (≠ Y416), R350 (= R537)
- binding selenium atom: F238 (≠ Y416), A348 (≠ W535), F349 (≠ L536), R350 (= R537)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 30% coverage: 195:568/1243 of query aligns to 3:381/420 of 3hrdA
- active site: Q207 (= Q385), L242 (≠ G420), R318 (= R495), H322 (≠ Y504), R350 (= R537)
- binding pterin cytosine dinucleotide: G236 (= G414), G237 (≠ C415), F238 (≠ Y416), R350 (= R537)
- binding magnesium ion: T206 (= T384), N208 (= N386), D212 (≠ L390), K241 (≠ N419), L242 (≠ G420), D243 (≠ A421), T305 (vs. gap), Y308 (= Y481), A309 (≠ P482), S346 (≠ A533)
- binding nicotinic acid: A314 (≠ P487), R318 (= R495), F352 (≠ V539)
- binding selenium atom: F238 (≠ Y416), G239 (= G417), A348 (≠ W535), F349 (≠ L536), R350 (= R537)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
24% identity, 30% coverage: 195:568/1243 of query aligns to 4:382/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
24% identity, 33% coverage: 198:611/1243 of query aligns to 17:436/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
24% identity, 33% coverage: 198:611/1243 of query aligns to 17:436/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
22% identity, 28% coverage: 276:621/1243 of query aligns to 110:439/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
22% identity, 40% coverage: 181:680/1243 of query aligns to 527:1026/1291 of 6a7xB
- active site: Q738 (= Q385), E773 (≠ N419), R851 (≠ Q502), H855 (≠ M506), R883 (= R537)
- binding bicarbonate ion: R810 (≠ G455), H811 (≠ T456), T880 (≠ S534), A881 (≠ W535), F885 (≠ V539), G886 (≠ S540), Q889 (≠ P543)
- binding fe2/s2 (inorganic) cluster: L715 (≠ I358)
- binding uric acid: E773 (≠ N419), R851 (≠ Q502), F885 (≠ V539), F980 (vs. gap), T981 (vs. gap)
Sites not aligning to the query:
- active site: 1231, 1232
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 1049, 1050, 1232
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
36% identity, 8% coverage: 1138:1237/1243 of query aligns to 24:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C1144), C33 (= C1147), H34 (= H1148), Y46 (≠ G1153), P47 (= P1154), T54 (≠ N1168), V66 (= V1180), I67 (= I1181), R73 (= R1186), I80 (= I1193), M82 (= M1196), P83 (= P1197)
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
22% identity, 40% coverage: 181:680/1243 of query aligns to 529:1028/1291 of 2e3tA
- active site: Q740 (= Q385), E775 (≠ N419), R853 (≠ Q502), H857 (≠ M506), R885 (= R537)
- binding bicarbonate ion: R812 (≠ G455), H813 (≠ T456), I850 (= I497), T882 (≠ S534), A883 (≠ W535), F887 (≠ V539), G888 (≠ S540), Q891 (≠ P543)
- binding calcium ion: E713 (≠ M354), H714 (= H355), Y716 (≠ S357), T809 (≠ E452), G810 (≠ P453), G840 (= G485), T843 (= T488), E844 (≠ L489), S847 (≠ T494), S880 (≠ P529), N881 (≠ A533)
- binding fe2/s2 (inorganic) cluster: L717 (≠ I358)
- binding uric acid: E775 (≠ N419), R853 (≠ Q502), F887 (≠ V539), F982 (vs. gap), T983 (vs. gap)
Sites not aligning to the query:
- active site: 1233, 1234
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 1051, 1052, 1234
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
22% identity, 40% coverage: 182:680/1243 of query aligns to 530:1028/1295 of 6a7xA
- active site: Q740 (= Q385), E775 (≠ N419), R853 (≠ Q502), H857 (≠ M506), R885 (= R537)
- binding bicarbonate ion: R812 (≠ G455), H813 (≠ T456), I850 (= I497), A883 (≠ W535), F884 (≠ L536), F887 (≠ V539), G888 (≠ S540), Q891 (≠ P543)
- binding uric acid: E775 (≠ N419), R853 (≠ Q502), F887 (≠ V539), F982 (≠ W627), T983 (≠ A628)
Sites not aligning to the query:
- active site: 1233, 1234
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 1052, 1234
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
22% identity, 40% coverage: 181:680/1243 of query aligns to 527:1026/1286 of 4yswA
- active site: Q738 (= Q385), E773 (≠ N419), R851 (≠ Q502), H855 (≠ M506), R883 (= R537)
- binding bicarbonate ion: R810 (≠ G455), H811 (≠ T456), I848 (= I497), T880 (≠ S534), A881 (≠ W535), F882 (≠ L536), F885 (≠ V539), G886 (≠ S540), Q889 (≠ P543)
- binding calcium ion: G838 (= G485), T841 (= T488), E842 (≠ L489), S845 (≠ T494), S878 (≠ P529), N879 (≠ A533)
- binding fe2/s2 (inorganic) cluster: L715 (≠ I358)
- binding uric acid: E773 (≠ N419), R851 (≠ Q502), F885 (≠ V539), F980 (vs. gap), T981 (vs. gap)
Sites not aligning to the query:
- active site: 1231, 1232
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 1050, 1232
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
22% identity, 40% coverage: 182:680/1243 of query aligns to 557:1055/1331 of P22985
- C992 (≠ K619) mutation to R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
Query Sequence
>Ac3H11_3427 FitnessBrowser__acidovorax_3H11:Ac3H11_3427
MNTPPSLRAHSPLTRADFHAAQGVLLVVRNPPPAPPPVKGQPALVAGNPAEGVEILIAVW
DDGSVTALNGHVDLGTGIRTALAQIVAEELDVPLAQVNMVLGDTTRAPNQGATIASASIQ
IHAKPLRTAAAQARHWLVAQAAERLGVPVEAMQVRAGVVQVTADPSRQVAYGALLAGAHT
TLELVDATPTKAAADYTVVGQSVPRVDIPAKVSGELVFVHDMRVPGMLHGRVVRPPYAGA
DHGDFIGNTLESVDQQSIAHIPGIRAVVVIRDFVGIVAEREEQAEQALRELKVRWKDWPG
FPRQDSAEALEQAIRANPATQRRLVDEGDVEGVLAALSADGQPMPRTYVWPYQMHGSIGP
SCAVAEWRSDDSTGRPRMNVWAGTQNPHVLRADLARLMGVGDVDIDLIRMEAAGCYGRNG
ADDVAADAALLSRAVGAPVRVQLTREQEHLWEPKGTAQLMQVRGGLKADGTVAAYDFETS
YPSNGAPTLALLLTRTIEPVAQAYEMGDRTARPPYQYDNLRVAVNDMPPIVRASWLRGVS
ALPNSFAHESYVDELATAAGVDPVQFRLQLLNDPRAAELVQATAEKAGWIRRTGPQQHPL
DGDWVQGQGFAYARYIHSKWPGFGAAWAAWVADVEVNKKTGEVHVRRVVVGHDAGLMVNP
AGVEQQVHGNVLQTTSRALKEQVTFEPVKQAVDNREWGSYPILSFREVPVIEVMHMPRQD
EAPLGSGESSSVPGTAAIANAIFDATGVRFRAPPFTPEVVRAGLNPLPGGAGNAAASGSP
PAEQAEVLSTLELPAPTVPASATWPAKRSPWARALALVAGGIAMGAALLGWRPSIAPVVQ
TVGASVYNAATIERGRLLAAAGDCAVCHTAPGGTPNTGGRAMETPFGKIYTTNLTPDAET
GIGQWSFSAFQRAMREGISQGGKHLYPAFPYTSFAKMSDDDLTALYAYLMAQPAVRAEVP
KTELTFPFSVRPLMAGWNALFHDATPFKPDPTRPPEWNRGAYLVQGVGHCGACHTPRNAL
GAELGGAAFLSGAMIDGWEAPALTGLSKAPVPWTADALYGYLRHGHSPQHGSASGPMAPV
VRELAHLPDDDIRAMASYLASFTAAEAATQPVSDPQQRAQTAVAQAAALAPQPGQAQRLF
DGACAACHHDGDGPKLLGVNVPLALNSNLHSDRPDNLLQVIVHGIREPAARDIGFMPGFG
HALSDAQITELAGYMRQRYAPGRPAWRDVPEALARVRAGPAHP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory