SitesBLAST
Comparing Ac3H11_3428 FitnessBrowser__acidovorax_3H11:Ac3H11_3428 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3B Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
44% identity, 92% coverage: 12:166/168 of query aligns to 7:154/154 of 8gy3B
- binding fe2/s2 (inorganic) cluster: G38 (= G45), C39 (= C46), G40 (= G47), G42 (= G49), C44 (= C51), G45 (= G52), C47 (= C54), C59 (= C66), C97 (= C109), C100 (= C112), Q101 (≠ L113), C132 (= C144), C134 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q96 (= Q108), C134 (= C146)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
47% identity, 90% coverage: 12:163/168 of query aligns to 9:155/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G45), C41 (= C46), D42 (≠ G47), G44 (= G49), C46 (= C51), G47 (= G52), C49 (= C54), C61 (= C66), C101 (= C109), G102 (= G110), C104 (= C112), C136 (= C144), C138 (= C146)
- binding pterin cytosine dinucleotide: Q100 (= Q108), C138 (= C146)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
41% identity, 95% coverage: 6:165/168 of query aligns to 3:156/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C46), S44 (≠ G49), H45 (≠ Q50), C46 (= C51), G47 (= G52), C49 (= C54), C61 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C135 (= C144), C137 (= C146)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
41% identity, 95% coverage: 6:165/168 of query aligns to 2:155/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ Y44), C40 (= C46), S43 (≠ G49), C45 (= C51), G46 (= G52), C48 (= C54), C60 (= C66), C99 (= C109), G100 (= G110), C102 (= C112), C134 (= C144), C136 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q108), C136 (= C146)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
42% identity, 80% coverage: 29:163/168 of query aligns to 31:160/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C46), S50 (≠ G49), C52 (= C51), G53 (= G52), C55 (= C54), C67 (= C66), C106 (= C109), G107 (= G110), C109 (= C112), C141 (= C144), C143 (= C146)
- binding pterin cytosine dinucleotide: Q105 (= Q108), C143 (= C146)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
45% identity, 79% coverage: 29:160/168 of query aligns to 24:151/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ Y44), C41 (= C46), G44 (= G49), C46 (= C51), G47 (= G52), C49 (= C54), C61 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C135 (= C144), C137 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q108), C137 (= C146)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
44% identity, 81% coverage: 29:164/168 of query aligns to 23:157/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ Y44), G39 (= G45), C40 (= C46), G41 (= G47), G43 (= G49), Q44 (= Q50), C45 (= C51), G46 (= G52), C48 (= C54), R58 (= R64), C60 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C137 (= C144), C139 (= C146)
- binding pterin cytosine dinucleotide: Q99 (= Q108), C139 (= C146)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
41% identity, 89% coverage: 12:160/168 of query aligns to 67:224/229 of P77165
- C99 (= C46) binding
- C104 (= C51) binding
- G105 (= G52) binding
- C107 (= C54) binding
- C119 (= C66) binding
- C158 (= C109) binding
- C161 (= C112) binding
- C208 (= C144) binding
- C210 (= C146) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
41% identity, 89% coverage: 12:160/168 of query aligns to 16:173/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G45), C48 (= C46), D49 (≠ G47), G51 (= G49), C53 (= C51), G54 (= G52), C56 (= C54), C68 (= C66), C107 (= C109), G108 (= G110), C110 (= C112), C157 (= C144), C159 (= C146)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
42% identity, 83% coverage: 25:164/168 of query aligns to 19:157/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ Y44), C40 (= C46), E41 (≠ G47), G43 (= G49), C45 (= C51), G46 (= G52), C48 (= C54), R58 (= R64), C60 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C137 (= C144), C139 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q108), C139 (= C146)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
42% identity, 83% coverage: 25:164/168 of query aligns to 19:157/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ Y44), C40 (= C46), E41 (≠ G47), G43 (= G49), C45 (= C51), G46 (= G52), C48 (= C54), R58 (= R64), C60 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C137 (= C144), C139 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q108), C139 (= C146)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
42% identity, 83% coverage: 25:164/168 of query aligns to 19:157/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ Y44), C40 (= C46), E41 (≠ G47), G43 (= G49), C45 (= C51), G46 (= G52), C48 (= C54), R58 (= R64), C60 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C137 (= C144), C139 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q108), C139 (= C146)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
42% identity, 83% coverage: 25:164/168 of query aligns to 19:157/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C46), E41 (≠ G47), G43 (= G49), C45 (= C51), G46 (= G52), C48 (= C54), R58 (= R64), C60 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C137 (= C144), C139 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q108), C139 (= C146)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
42% identity, 83% coverage: 25:164/168 of query aligns to 19:157/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ Y44), C40 (= C46), E41 (≠ G47), G43 (= G49), C45 (= C51), G46 (= G52), C48 (= C54), R58 (= R64), C60 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C137 (= C144), C139 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q108), C139 (= C146)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
42% identity, 83% coverage: 25:164/168 of query aligns to 19:157/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ Y44), C40 (= C46), E41 (≠ G47), G43 (= G49), C45 (= C51), G46 (= G52), C48 (= C54), R58 (= R64), C60 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C137 (= C144), C139 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q108), C139 (= C146)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
42% identity, 83% coverage: 25:164/168 of query aligns to 19:157/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ Y44), C40 (= C46), E41 (≠ G47), G43 (= G49), C45 (= C51), G46 (= G52), C48 (= C54), R58 (= R64), C60 (= C66), Q99 (= Q108), C100 (= C109), G101 (= G110), C103 (= C112), C137 (= C144), C139 (= C146)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q108), C139 (= C146)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
42% identity, 83% coverage: 25:164/168 of query aligns to 19:157/907 of Q46509
- C40 (= C46) binding
- C45 (= C51) binding
- C48 (= C54) binding
- C60 (= C66) binding
- C100 (= C109) binding
- C103 (= C112) binding
- C137 (= C144) binding
- C139 (= C146) binding
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
37% identity, 90% coverage: 10:160/168 of query aligns to 8:153/166 of P19921
- C42 (= C46) binding
- C47 (= C51) binding
- C50 (= C54) binding
- C62 (= C66) binding
- C102 (= C109) binding
- C105 (= C112) binding
- C137 (= C144) binding
- C139 (= C146) binding
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
37% identity, 90% coverage: 10:160/168 of query aligns to 6:151/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G49), H44 (≠ Q50)
- binding fe2/s2 (inorganic) cluster: I38 (≠ Y44), G39 (= G45), C40 (= C46), S43 (≠ G49), C45 (= C51), G46 (= G52), C48 (= C54), C60 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C135 (= C144), C137 (= C146)
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
37% identity, 90% coverage: 10:160/168 of query aligns to 6:151/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G49), H44 (≠ Q50)
- binding fe2/s2 (inorganic) cluster: C40 (= C46), S43 (≠ G49), C45 (= C51), G46 (= G52), C48 (= C54), C60 (= C66), C100 (= C109), G101 (= G110), C103 (= C112), C135 (= C144), C137 (= C146)
- binding pterin cytosine dinucleotide: Q99 (= Q108), C137 (= C146)
Query Sequence
>Ac3H11_3428 FitnessBrowser__acidovorax_3H11:Ac3H11_3428
MHAPASISPVVVNGQPFALPKSTLASATLLHVLRNDLLLNGPKYGCGLGQCGACTVLVDG
IAARACVIPAQGVAGREVTTLEGLPGRCSRTAGLHPVQQAFVDEQAAQCGYCLNGMVMMA
VALLERNPDPDEAAVRRELSGNLCRCGTHVEIIRAVLRAAQLMREAQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory