Comparing Ac3H11_3430 FitnessBrowser__acidovorax_3H11:Ac3H11_3430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
43% identity, 96% coverage: 10:249/249 of query aligns to 4:239/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 95% coverage: 12:247/249 of query aligns to 2:234/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 94% coverage: 13:247/249 of query aligns to 3:234/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 94% coverage: 13:247/249 of query aligns to 3:234/238 of 6s8gA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 94% coverage: 13:247/249 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 94% coverage: 13:247/249 of query aligns to 3:234/234 of 4p31A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 94% coverage: 13:247/249 of query aligns to 3:234/235 of 6mhzA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 92% coverage: 12:239/249 of query aligns to 4:240/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 92% coverage: 12:239/249 of query aligns to 4:240/253 of 1g9xB
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 94% coverage: 13:246/249 of query aligns to 3:233/233 of 6b8bA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 94% coverage: 13:247/249 of query aligns to 4:235/241 of 6mbnA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
30% identity, 91% coverage: 10:235/249 of query aligns to 2:230/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
26% identity, 95% coverage: 12:248/249 of query aligns to 2:237/241 of 4u00A
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
31% identity, 83% coverage: 30:236/249 of query aligns to 3828:4029/5034 of Q5SSE9
Sites not aligning to the query:
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
28% identity, 90% coverage: 12:236/249 of query aligns to 3:221/247 of P55339
7o12B Abc transporter nosdfy, amppnp-bound in gdn (see paper)
31% identity, 91% coverage: 13:238/249 of query aligns to 3:216/298 of 7o12B
7o17B Abc transporter nosdfy e154q, atp-bound in lipid nanodisc (see paper)
31% identity, 91% coverage: 13:238/249 of query aligns to 3:216/298 of 7o17B
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
30% identity, 82% coverage: 33:236/249 of query aligns to 2075:2272/2435 of Q9BZC7
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 95% coverage: 12:248/249 of query aligns to 3:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 95% coverage: 12:248/249 of query aligns to 3:239/242 of 3c41J
>Ac3H11_3430 FitnessBrowser__acidovorax_3H11:Ac3H11_3430
MTMTTHNPKELLLQAKGLQAWYGAAQILYDVDLDVRRGEVVALMGRNGAGKSTTLKTLMG
MLAKRKGSIQFMGRDLSRTDPHDAARLGLGFVPEDRRVFTDLTVMENLEVGRQPARHWPD
GTAAPVWTPERLFKLFPNLGEMPQRPGGRMSGGEQQMLTVARTLMGNPYLVLLDEPSEGV
APVIVEQMAHMILELKEQGVSILLSEQNMHFAELVSDRAYVLEKGQIRYQASMEELAAND
EVRRAYLSV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory