SitesBLAST
Comparing Ac3H11_3445 FitnessBrowser__acidovorax_3H11:Ac3H11_3445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
39% identity, 96% coverage: 6:253/257 of query aligns to 1:248/252 of 1vl8B
- active site: G17 (= G22), S143 (= S148), I154 (≠ T161), Y157 (= Y164), K161 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G18), R16 (= R21), G17 (= G22), L18 (= L23), S37 (≠ A42), R38 (= R43), C63 (≠ N67), D64 (= D68), V65 (≠ L69), A91 (≠ N95), A92 (= A96), G93 (= G97), I94 (≠ A98), V114 (≠ L118), I141 (≠ T146), S143 (= S148), Y157 (= Y164), K161 (= K168), P187 (= P194), G188 (= G195), Y190 (≠ F197), T192 (≠ S199), M194 (= M201), T195 (≠ A202)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 95% coverage: 9:253/257 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G22), S142 (= S148), Q152 (≠ G158), Y155 (≠ T161), K159 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (= S20), R15 (= R21), G16 (= G22), I17 (≠ L23), N35 (≠ T41), Y36 (≠ A42), N37 (≠ R43), G38 (≠ K44), S39 (≠ A45), N63 (≠ D68), V64 (≠ L69), N90 (= N95), A91 (= A96), I93 (≠ A98), I113 (≠ L118), S142 (= S148), Y155 (≠ T161), K159 (= K168), P185 (= P194), I188 (≠ F197), T190 (≠ S199)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
38% identity, 96% coverage: 7:253/257 of query aligns to 6:243/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G18), D19 (≠ S20), L22 (= L23), I42 (≠ A45), D65 (= D68), M66 (≠ L69), N92 (= N95), A93 (= A96), G94 (= G97), L115 (= L118), I143 (≠ T146), S145 (= S148), Y158 (= Y164), K162 (= K168), G189 (= G195), M191 (= M201), T193 (≠ S203), N195 (≠ L205)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
36% identity, 95% coverage: 13:256/257 of query aligns to 3:244/244 of 1edoA
- active site: G12 (= G22), S138 (= S148), Y151 (= Y164), K155 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), S10 (= S20), R11 (= R21), I13 (≠ L23), N31 (≠ T41), Y32 (vs. gap), A33 (= A42), R34 (= R43), S35 (≠ K44), D59 (= D68), V60 (≠ L69), N86 (= N95), A87 (= A96), S138 (= S148), Y151 (= Y164), K155 (= K168), P181 (= P194), G182 (= G195), I184 (≠ F197), S186 (= S199), M188 (= M201)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
34% identity, 96% coverage: 7:253/257 of query aligns to 12:256/261 of 5u9pB
- active site: G27 (= G22), S152 (= S148), Y165 (= Y164), K169 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G18), R26 (= R21), G27 (= G22), I28 (≠ L23), R48 (= R43), D73 (= D68), V74 (≠ L69), N100 (= N95), A101 (= A96), I150 (≠ T146), Y165 (= Y164), K169 (= K168), P195 (= P194), F198 (= F197), T200 (≠ S199), L202 (≠ M201), N203 (≠ A202)
7vyqA Short chain dehydrogenase (scr) cryoem structure with NADP and ethyl 4-chloroacetoacetate (see paper)
36% identity, 98% coverage: 2:253/257 of query aligns to 26:276/280 of 7vyqA
- binding ethyl 4-chloranyl-3-oxidanylidene-butanoate: T123 (= T99), S173 (= S148), Q183 (≠ G158), Y219 (≠ F196), F227 (≠ G204), W236 (≠ M213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G42 (= G18), S44 (= S20), G45 (≠ R21), G46 (= G22), I47 (≠ L23), N67 (≠ T41), H69 (≠ R43), I93 (≠ L69), N119 (= N95), A120 (= A96), G121 (= G97), V144 (≠ L118), S173 (= S148), Y188 (= Y164), K192 (= K168), P217 (= P194), G218 (= G195), I220 (≠ F197), T222 (≠ S199), I224 (≠ M201), T225 (≠ A202)
7dlmA Short chain dehydrogenase (scr) crystal structure with NADPH (see paper)
36% identity, 98% coverage: 2:253/257 of query aligns to 26:276/280 of 7dlmA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G42 (= G18), S44 (= S20), G45 (≠ R21), G46 (= G22), I47 (≠ L23), Y66 (vs. gap), N67 (≠ T41), S68 (≠ A42), H69 (≠ R43), C91 (≠ N67), N92 (≠ D68), I93 (≠ L69), N119 (= N95), A120 (= A96), G121 (= G97), V122 (≠ A98), T171 (= T146), S173 (= S148), Y188 (= Y164), K192 (= K168), P217 (= P194), G218 (= G195), I220 (≠ F197), T222 (≠ S199), I224 (≠ M201)
1yxmB Crystal structure of peroxisomal trans 2-enoyl coa reductase
32% identity, 96% coverage: 9:256/257 of query aligns to 9:252/283 of 1yxmB
- active site: G22 (= G22), V152 (= V149), G157 (= G154), H163 (≠ N160), S164 (≠ T161), R168 (≠ K168)
- binding adenine: S42 (≠ A42), R43 (= R43), C72 (≠ N67), N73 (≠ D68), I74 (≠ L69), T123 (≠ L118)
A7DY56 Tropinone reductase; EC 1.1.1.206; EC 1.1.1.236 from Cochlearia officinalis (Common scurvygrass) (see paper)
33% identity, 98% coverage: 4:256/257 of query aligns to 11:262/273 of A7DY56
- Y209 (≠ L205) mutation to S: Loss of tropinone or nortropinone reduction, but faster reduction of cyclohexanones.
2b4qA Pseudomonas aeruginosa rhlg/NADP active-site complex (see paper)
36% identity, 97% coverage: 7:256/257 of query aligns to 5:256/256 of 2b4qA
- active site: G20 (= G22), S148 (= S148), V149 (= V149), Y162 (= Y164), K166 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G18), S18 (= S20), R19 (= R21), I21 (≠ L23), A40 (= A42), R41 (= R43), D42 (≠ K44), D65 (= D68), L66 (= L69), S67 (≠ Q70), N92 (= N95), A93 (= A96), G94 (= G97), I146 (≠ T146), G147 (≠ A147), S148 (= S148), Y162 (= Y164), K166 (= K168), P192 (= P194), G193 (= G195), R194 (≠ F196), F195 (= F197), S197 (= S199), M199 (= M201)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 98% coverage: 7:257/257 of query aligns to 1:244/244 of P0AEK2
- GASR 12:15 (≠ GGSR 18:21) binding
- T37 (≠ R43) binding
- NV 59:60 (≠ VV 65:66) binding
- N86 (= N95) binding
- Y151 (= Y164) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YNTSK 164:168) binding
- A154 (≠ S167) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K168) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ F197) binding
- E233 (= E246) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
33% identity, 93% coverage: 14:253/257 of query aligns to 7:243/246 of 3osuA
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
34% identity, 97% coverage: 8:257/257 of query aligns to 1:243/243 of 1q7bA
- active site: G15 (= G22), E101 (≠ A111), S137 (= S148), Q147 (≠ G158), Y150 (= Y164), K154 (= K168)
- binding calcium ion: E232 (= E246), T233 (≠ S247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G18), S13 (= S20), R14 (= R21), T36 (≠ R43), N58 (≠ V65), V59 (= V66), N85 (= N95), A86 (= A96), G87 (= G97), I88 (≠ A98), S137 (= S148), Y150 (= Y164), K154 (= K168), P180 (= P194), G181 (= G195), I183 (≠ F197)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
35% identity, 95% coverage: 9:253/257 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G22), S145 (= S148), F155 (≠ M159), Y158 (= Y164), K162 (= K168), K203 (≠ E207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G18), T17 (≠ S20), D18 (≠ R21), G19 (= G22), I20 (≠ L23), S39 (≠ A42), R40 (= R43), K41 (= K44), N44 (≠ E47), H65 (≠ D68), V66 (≠ L69), N92 (= N95), A94 (≠ G97), S145 (= S148), Y158 (= Y164), K162 (= K168), P188 (= P194), G189 (= G195), L190 (≠ F196), I191 (≠ F197), T193 (≠ S199), F195 (≠ M201), S196 (≠ A202)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
33% identity, 97% coverage: 8:257/257 of query aligns to 1:243/243 of 1q7cA
- active site: G15 (= G22), S137 (= S148), Q147 (≠ G158), F150 (≠ Y164), K154 (= K168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G18), S13 (= S20), R14 (= R21), A35 (= A42), T36 (≠ R43), L57 (≠ T64), N58 (≠ V65), V59 (= V66), G87 (= G97), I88 (≠ A98)
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
35% identity, 95% coverage: 9:253/257 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ T155) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ M159) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (= T177) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 96% coverage: 11:257/257 of query aligns to 5:244/244 of P0A2C9
- M125 (= M135) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A236) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S237) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
3gdfA Crystal structure of the NADP-dependent mannitol dehydrogenase from cladosporium herbarum. (see paper)
36% identity, 98% coverage: 2:253/257 of query aligns to 11:263/267 of 3gdfA
7krgF Crystal structure of mannitol dehydrogenase (chmdh) from cladosporium herbarum in complex with NADP+ and na (see paper)
36% identity, 98% coverage: 2:253/257 of query aligns to 14:266/270 of 7krgF
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G30 (= G18), S32 (vs. gap), G36 (= G22), M37 (≠ L23), A57 (= A42), S58 (≠ R43), R59 (≠ K44), Q84 (≠ D68), V85 (≠ L69), N111 (= N95), A112 (= A96), G113 (= G97), T161 (= T146), S163 (= S148), Y178 (= Y164), K182 (= K168), G208 (= G195), I210 (≠ F197), T212 (≠ S199), L214 (≠ M201)
Q9BY49 Peroxisomal trans-2-enoyl-CoA reductase; TERP; 2,4-dienoyl-CoA reductase-related protein; DCR-RP; HPDHase; Short chain dehydrogenase/reductase family 29C member 1; pVI-ARL; EC 1.3.1.38 from Homo sapiens (Human) (see paper)
32% identity, 96% coverage: 9:256/257 of query aligns to 16:267/303 of Q9BY49
Sites not aligning to the query:
- 303 mutation Missing: Abolishes localization to peroxisomes.
Query Sequence
>Ac3H11_3445 FitnessBrowser__acidovorax_3H11:Ac3H11_3445
MSVKQLFDLTGQVALVTGGSRGLGLQMAEALGEMGAKLAITARKADELAEAKKHLEAQGY
EVLTVVNDLQKTEDIPGLVDQVVERFGTIDILVNNAGATWGAKAEDYPDAAWHKVMDLNV
SAPFFLSREVGKRCMIPRGKGSIIVTASVAALKGTPPGMNTIAYNTSKAAALHFARTLAS
EWGHYGVRVNAICPGFFPSKMASGLIEKLGPAMIERTPLRRIGGEEDLKGAVVFLASNAS
RHITGESIVVDGGASLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory