SitesBLAST
Comparing Ac3H11_3461 FitnessBrowser__acidovorax_3H11:Ac3H11_3461 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A7B3 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Escherichia coli (strain K12) (see paper)
37% identity, 99% coverage: 1:296/299 of query aligns to 1:289/292 of P0A7B3
- R175 (= R183) mutation to E: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to G: Exhibits NADH kinase activity in addition to NAD kinase activity. Reduces the Vmax of the NAD kinase activity.; mutation to H: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to I: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to K: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to Q: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to T: Exhibits NADH kinase activity in addition to NAD kinase activity.
7mh7A Crystal structure of NAD kinase from pseudomonas aeruginosa pao1
37% identity, 97% coverage: 5:294/299 of query aligns to 3:286/290 of 7mh7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D71 (= D81), G72 (= G82), R93 (≠ Q103), F98 (= F108), N145 (= N155), D146 (= D156), T186 (= T196), A187 (= A197), Y188 (= Y198), S191 (= S201), D244 (= D252), K283 (= K291)
P9WHV7 NAD kinase; ATP-dependent NAD kinase; Poly(P)-dependent NAD kinase; PPNK; EC 2.7.1.23 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
32% identity, 74% coverage: 72:293/299 of query aligns to 76:298/307 of P9WHV7
- D85 (= D81) mutation to A: Abolishes catalytic activity.
- N159 (= N155) mutation to A: Abolishes catalytic activity.
- NE 159:160 (≠ ND 155:156) binding
- E160 (≠ D156) mutation to A: Abolishes catalytic activity.
- G190 (= G186) mutation to A: Abolishes catalytic activity.
- L192 (≠ I188) mutation to A: Abolishes catalytic activity.
- T195 (≠ S191) mutation to A: It promotes stronger allosteric interactions.
- P196 (= P192) mutation to A: Abolishes catalytic activity.
- T197 (= T193) binding ; mutation to A: Abolishes catalytic activity.
- G198 (= G194) mutation to A: Abolishes catalytic activity.
- S199 (= S195) mutation to A: Lower catalytic efficiency. A perturbation of the allosteric interactions is observed when NAD is used as substrate.
- T200 (= T196) mutation to A: Abolishes catalytic activity.
- TAYAFS 200:205 (≠ TAYSLS 196:201) binding
- Y202 (= Y198) mutation to A: Abolishes catalytic activity.
- G207 (= G203) mutation to A: Abolishes catalytic activity.
- G208 (= G204) mutation to A: Possesses 30% of the activity compared to the wild-type enzyme. While mutant affects the catalytic efficiency, it does not alter the binding affinity for ATP and poly(P). It causes a decrease in the affinity for NAD and alters the allosteric interactions mediated by the dinucleotide, both in the presence of poly(P) and ATP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
O13863 Uncharacterized kinase C1B1.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 77% coverage: 67:296/299 of query aligns to 270:513/537 of O13863
Sites not aligning to the query:
- 72 modified: Phosphoserine
1y3iA Crystal structure of mycobacterium tuberculosis NAD kinase-NAD complex (see paper)
31% identity, 72% coverage: 79:293/299 of query aligns to 12:227/231 of 1y3iA
- binding nicotinamide-adenine-dinucleotide: D14 (= D81), G15 (= G82), R38 (= R105), F41 (= F108), L42 (≠ I109), N88 (= N155), E89 (≠ D156), T129 (= T196), A130 (= A197), Y131 (= Y198), S134 (= S201)
Q9P7K3 Uncharacterized kinase C24B10.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 75% coverage: 73:295/299 of query aligns to 176:407/449 of Q9P7K3
Sites not aligning to the query:
- 420 modified: Phosphoserine
3afoA Crystal structure of yeast nadh kinase complexed with nadh
32% identity, 59% coverage: 67:241/299 of query aligns to 106:282/360 of 3afoA
- binding 1,4-dihydronicotinamide adenine dinucleotide: D120 (= D81), G121 (= G82), L124 (= L85), F148 (= F108), N196 (= N155), D197 (= D156), T237 (= T196), A238 (= A197), Y239 (= Y198), S242 (= S201)
Sites not aligning to the query:
1z0zA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with NAD (see paper)
32% identity, 60% coverage: 73:252/299 of query aligns to 41:217/249 of 1z0zA
- active site: E96 (= E130), C105 (≠ A139)
- binding nicotinamide-adenine-dinucleotide: N115 (= N155), E116 (≠ D156), M127 (= M167), R143 (= R183), D145 (= D185), T156 (= T196), Y158 (= Y198), S161 (= S201), F182 (≠ H222), D209 (vs. gap), G210 (vs. gap)
1z0sA Crystal structure of an NAD kinase from archaeoglobus fulgidus in complex with atp (see paper)
32% identity, 60% coverage: 73:252/299 of query aligns to 41:217/249 of 1z0sA
- active site: E96 (= E130), C105 (≠ A139)
- binding adenosine-5'-triphosphate: R54 (≠ G86), N115 (= N155), E116 (≠ D156), A125 (≠ S165), K126 (≠ G166), M127 (= M167), D145 (= D185), G157 (≠ A197), Y158 (= Y198), S161 (= S201), A180 (= A220), F182 (≠ H222), D209 (vs. gap)
- binding pyrophosphate 2-: G48 (= G80), G50 (= G82), T51 (= T83), R54 (≠ G86), R72 (= R105)
Sites not aligning to the query:
1suwA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with its substrate and product: insights into the catalysis of NAD kinase (see paper)
32% identity, 60% coverage: 73:252/299 of query aligns to 41:217/249 of 1suwA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G48 (= G80), D49 (= D81), G50 (= G82), N115 (= N155), E116 (≠ D156), A125 (≠ S165), M127 (= M167), R143 (= R183), D145 (= D185), T156 (= T196), Y158 (= Y198), S161 (= S201), F182 (≠ H222), D209 (vs. gap), G210 (vs. gap)
O30297 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
32% identity, 60% coverage: 73:252/299 of query aligns to 41:217/249 of O30297
6rc0A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
29% identity, 64% coverage: 73:263/299 of query aligns to 37:227/261 of 6rc0A
5ejiA Crystal structure of NAD kinase w78f mutant from listeria monocytogenes in complex with NADP/mn++/ppi
28% identity, 73% coverage: 73:290/299 of query aligns to 37:252/260 of 5ejiA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G44 (= G80), D45 (= D81), L72 (= L106), G73 (= G107), F74 (= F108), Y75 (≠ I109), N118 (= N155), E119 (≠ D156), T157 (= T196), A158 (= A197), Y159 (= Y198), S162 (= S201)
- binding pyrophosphate 2-: G44 (= G80), D45 (= D81), G46 (= G82), T47 (= T83)
3v8nA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with 8-bromo-5'-amino-5'-deoxyadenosine, reacted with a citrate molecule in n site (see paper)
29% identity, 73% coverage: 73:290/299 of query aligns to 37:249/257 of 3v8nA
8a9vA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 73% coverage: 73:290/299 of query aligns to 37:253/261 of 8a9vA
- binding ~{N}-[[(2~{R},3~{S},4~{R},5~{R})-5-[8-[3-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy]prop-1-ynyl]-6-azanyl-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-2-azanyl-ethanesulfonamide: D45 (= D81), L49 (= L85), L72 (= L106), F74 (= F108), Y75 (≠ I109), N119 (= N155), E120 (≠ D156), T158 (= T196), A159 (= A197), Y160 (= Y198), S163 (= S201), H220 (≠ M253)
7zzjA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 73% coverage: 73:290/299 of query aligns to 37:253/261 of 7zzjA
- binding (1~{R},23~{R},24~{S},25~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-24,25-bis(oxidanyl)-26-oxa-2,4,6,9,14,17,21-heptazatetracyclo[21.2.1.0^{2,10}.0^{3,8}]hexacosa-3(8),4,6,9-tetraen-11-yne-16,20-dione: D45 (= D81), G46 (= G82), L72 (= L106), F74 (= F108), Y75 (≠ I109), N119 (= N155), E120 (≠ D156), T158 (= T196), A159 (= A197), Y160 (= Y198), S163 (= S201), H220 (≠ M253)
7zzgA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 73% coverage: 73:290/299 of query aligns to 37:253/261 of 7zzgA
- binding (1~{R},24~{R},25~{S},26~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-25,26-bis(oxidanyl)-27-oxa-2,4,6,9,14,17,20,22-octazatetracyclo[22.2.1.0^{2,10}.0^{3,8}]heptacosa-3(8),4,6,9-tetraen-11-yne-16,21-dione: D45 (= D81), G46 (= G82), F74 (= F108), Y75 (≠ I109), N119 (= N155), E120 (≠ D156), T158 (= T196), A159 (= A197), Y160 (= Y198), S163 (= S201), H220 (≠ M253)
7zzeA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 73% coverage: 73:290/299 of query aligns to 37:253/261 of 7zzeA
- binding (1~{R},25~{R},26~{S},27~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-26,27-bis(oxidanyl)-28-oxa-2,4,6,9,14,17,21,23-octazatetracyclo[23.2.1.0^{2,10}.0^{3,8}]octacosa-3(8),4,6,9-tetraen-11-yne-16,22-dione: D45 (= D81), G46 (= G82), F74 (= F108), Y75 (≠ I109), N119 (= N155), E120 (≠ D156), S155 (≠ T193), T158 (= T196), A159 (= A197), Y160 (= Y198), S163 (= S201), H220 (≠ M253)
7zzcA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 73% coverage: 73:290/299 of query aligns to 37:253/261 of 7zzcA
- binding 2-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-[(2-azanylethylsulfonylamino)methyl]-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynyl]amino]ethanoic acid: D45 (= D81), G46 (= G82), L49 (= L85), F74 (= F108), Y75 (≠ I109), N119 (= N155), E120 (≠ D156), T158 (= T196), A159 (= A197), Y160 (= Y198), S163 (= S201)
7zzaA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 73% coverage: 73:290/299 of query aligns to 37:253/261 of 7zzaA
- binding 2-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-[(3-azanylpropylcarbamoylamino)methyl]-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynyl]amino]ethanoic acid: D45 (= D81), G46 (= G82), L49 (= L85), F74 (= F108), Y75 (≠ I109), N119 (= N155), E120 (≠ D156), T158 (= T196), A159 (= A197), Y160 (= Y198), S163 (= S201)
Query Sequence
>Ac3H11_3461 FitnessBrowser__acidovorax_3H11:Ac3H11_3461
MTSNFRHVALIGKYQASSAGSTGDSSRQALEDIAHFLERQGCEVALEAETASNAGLTHDY
PSLNVDEIGARCDLGLVVGGDGTMLGIGRRLARFGTPLIGINQGRLGFITDIPFDTYQAT
LSPMLKGAYEEDLRPLMHATVVRDERIVFEALAMNDVVVNRGATSGMVELRVEVGGRLVA
NQRADGLIIASPTGSTAYSLSAGGPMLHPSIPGWVLVPIAPHTLSNRPIVLSDATEVAVE
VVSGRDVSANFDMQSLASLLHGDRILVKRSEHCVRFLHPQGWNYFATLRKKLRWNEGGS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory