Comparing Ac3H11_3524 FitnessBrowser__acidovorax_3H11:Ac3H11_3524 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
46% identity, 92% coverage: 24:331/335 of query aligns to 3:310/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
46% identity, 92% coverage: 24:331/335 of query aligns to 2:309/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
46% identity, 92% coverage: 24:331/335 of query aligns to 2:309/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
46% identity, 92% coverage: 24:331/335 of query aligns to 2:309/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
46% identity, 92% coverage: 24:331/335 of query aligns to 2:309/310 of 7bcnA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
36% identity, 87% coverage: 28:318/335 of query aligns to 3:291/301 of 4pdhA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
37% identity, 87% coverage: 29:319/335 of query aligns to 4:292/303 of 4pddA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
34% identity, 87% coverage: 28:318/335 of query aligns to 6:294/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
34% identity, 87% coverage: 28:318/335 of query aligns to 5:293/303 of 4p9kA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
33% identity, 87% coverage: 28:319/335 of query aligns to 3:291/301 of 4nq8B
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
36% identity, 80% coverage: 41:308/335 of query aligns to 16:280/304 of 4xeqB
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
32% identity, 87% coverage: 38:328/335 of query aligns to 12:297/300 of 4n8yA
Sites not aligning to the query:
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
30% identity, 82% coverage: 37:312/335 of query aligns to 10:283/300 of 4pf8A
Sites not aligning to the query:
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
31% identity, 90% coverage: 29:330/335 of query aligns to 5:313/314 of 4p8bA
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
32% identity, 84% coverage: 33:315/335 of query aligns to 4:289/301 of 4x04A
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
32% identity, 70% coverage: 37:270/335 of query aligns to 14:247/304 of 4x8rA
Sites not aligning to the query:
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
32% identity, 97% coverage: 1:324/335 of query aligns to 2:321/329 of P44542
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
33% identity, 89% coverage: 26:324/335 of query aligns to 1:297/305 of 2cexB
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
33% identity, 89% coverage: 26:324/335 of query aligns to 2:298/310 of 3b50A
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
33% identity, 89% coverage: 26:324/335 of query aligns to 1:297/304 of 2cexA
>Ac3H11_3524 FitnessBrowser__acidovorax_3H11:Ac3H11_3524
MQFKTLALAATLLAALAAPVAAQVKEHTFKVGIGLSDDHPQAQAVRHFAERLQAKSGGKM
NAKLFASGALGNDVSMTSALRGGTLEMTIPDSSTLMSLIKPFGVLNLPLTFNTEAEADAL
LDGPFGQKLLAMLPDKGLIGLGFWENGFRHVTNSRRAINTADDLAGLKLRVIQSPLFLDT
FSALGTNATPMPFTELYTAMEQKAVDGQENPPATILASKFYEVQKHLVLSRHMYSAWVLL
ISKKTWDGLSADERKIVQEAAREATLFERKTIRAFSQTALGELKKAGMQITELPAAEQAK
LRTKLQPVLAKYGKEFGEETTSEMMGELAKARGGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory