Comparing Ac3H11_3541 FitnessBrowser__acidovorax_3H11:Ac3H11_3541 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
63% identity, 97% coverage: 7:292/295 of query aligns to 3:281/282 of 5ve7A
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
62% identity, 97% coverage: 7:292/295 of query aligns to 5:287/290 of 5i1fA
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
53% identity, 98% coverage: 7:294/295 of query aligns to 5:288/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
51% identity, 91% coverage: 6:272/295 of query aligns to 7:271/281 of 8f73E
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
47% identity, 97% coverage: 7:293/295 of query aligns to 2:289/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
47% identity, 97% coverage: 7:293/295 of query aligns to 2:289/290 of 6k8dA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
48% identity, 90% coverage: 7:272/295 of query aligns to 2:257/264 of 3jukD
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
47% identity, 97% coverage: 7:293/295 of query aligns to 2:284/285 of 6ikzB
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
48% identity, 90% coverage: 7:272/295 of query aligns to 2:257/265 of 3jukA
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
46% identity, 97% coverage: 7:293/295 of query aligns to 5:254/255 of 2ux8A
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
42% identity, 97% coverage: 6:290/295 of query aligns to 1:284/291 of 8b6dA
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
41% identity, 97% coverage: 6:290/295 of query aligns to 1:279/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
38% identity, 98% coverage: 5:293/295 of query aligns to 1:289/299 of 2pa4B
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
28% identity, 89% coverage: 8:271/295 of query aligns to 12:244/302 of 4b2xB
Sites not aligning to the query:
3zllA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
28% identity, 89% coverage: 8:271/295 of query aligns to 7:239/297 of 3zllA
Sites not aligning to the query:
3zlkA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
28% identity, 89% coverage: 8:271/295 of query aligns to 7:239/297 of 3zlkA
Sites not aligning to the query:
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
28% identity, 89% coverage: 8:271/295 of query aligns to 8:240/298 of 5fuhA
Sites not aligning to the query:
4b4bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
28% identity, 89% coverage: 8:271/295 of query aligns to 8:240/298 of 4b4bA
Sites not aligning to the query:
5fu8A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
28% identity, 89% coverage: 8:271/295 of query aligns to 7:239/297 of 5fu8A
Sites not aligning to the query:
4b2wA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
28% identity, 89% coverage: 8:271/295 of query aligns to 7:239/297 of 4b2wA
Sites not aligning to the query:
>Ac3H11_3541 FitnessBrowser__acidovorax_3H11:Ac3H11_3541
MTVATTVRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVT
GRSKRAIEDHFDTAYELEAELEAANKKELLALVRSIQPDDMDCAFVRQPRSLGLGHAVLC
AEPLVGKEPFAVLLADDLMVGPPGGQPVLAQMASAFRQQGRSVIAVQEVPEDQVHKYGIV
AGEPAGGPLIRIERIVEKPKADVAPSRMGVAGRYILTPGVFDEIRNQPRGVGGEIQLTDG
IARLMQHEAVYAFQYQGKRYDCGSKEGFLEATVELALQHPQVGAHFREYLKALAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory