Comparing Ac3H11_3567 FitnessBrowser__acidovorax_3H11:Ac3H11_3567 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
53% identity, 100% coverage: 1:359/360 of query aligns to 1:360/365 of Q3J1R2
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
54% identity, 92% coverage: 30:359/360 of query aligns to 4:332/337 of 2hzlB
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
51% identity, 91% coverage: 26:354/360 of query aligns to 1:328/344 of 4yicA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
46% identity, 89% coverage: 30:348/360 of query aligns to 5:322/330 of 7ug8B
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
41% identity, 89% coverage: 31:351/360 of query aligns to 4:324/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
38% identity, 90% coverage: 31:354/360 of query aligns to 5:329/329 of 4petA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
31% identity, 64% coverage: 51:280/360 of query aligns to 21:252/315 of 4pe3A
Sites not aligning to the query:
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 64% coverage: 1:231/360 of query aligns to 4:234/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
29% identity, 56% coverage: 31:231/360 of query aligns to 4:203/330 of 2zzwA
Sites not aligning to the query:
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
29% identity, 56% coverage: 31:231/360 of query aligns to 4:203/330 of 2zzvA
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
28% identity, 50% coverage: 31:210/360 of query aligns to 4:182/563 of 7e9yA
Sites not aligning to the query:
2pfyA Crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid (see paper)
27% identity, 66% coverage: 29:266/360 of query aligns to 1:232/301 of 2pfyA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
27% identity, 77% coverage: 54:329/360 of query aligns to 24:297/300 of 4n8yA
Sites not aligning to the query:
3gyyD The ectoine binding protein of the teaabc trap transporter teaa in the apo-state (see paper)
24% identity, 69% coverage: 50:297/360 of query aligns to 16:264/311 of 3gyyD
Sites not aligning to the query:
2vpnB High-resolution structure of the periplasmic ectoine- binding protein from teaabc trap-transporter of halomonas elongata (see paper)
24% identity, 69% coverage: 50:297/360 of query aligns to 16:264/310 of 2vpnB
Sites not aligning to the query:
E1VBK1 Ectoine-binding periplasmic protein TeaA from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) (see 2 papers)
24% identity, 69% coverage: 50:297/360 of query aligns to 41:289/341 of E1VBK1
Sites not aligning to the query:
2pfzA Crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid (see paper)
23% identity, 66% coverage: 31:267/360 of query aligns to 2:231/301 of 2pfzA
6wgmA Crystal structure of a marine metagenome trap solute binding protein specific for pyroglutamate (sorcerer ii global ocean sampling expedition, unidentified microbe, scf7180008839099) in complex with co-purified pyroglutamate
24% identity, 69% coverage: 51:297/360 of query aligns to 24:264/304 of 6wgmA
2vpoA High resolution structure of the periplasmic binding protein teaa from teaabc trap transporter of halomonas elongata in complex with hydroxyectoine (see paper)
24% identity, 69% coverage: 50:297/360 of query aligns to 16:260/307 of 2vpoA
Sites not aligning to the query:
2vpnA High-resolution structure of the periplasmic ectoine- binding protein from teaabc trap-transporter of halomonas elongata (see paper)
24% identity, 69% coverage: 50:297/360 of query aligns to 16:260/306 of 2vpnA
Sites not aligning to the query:
>Ac3H11_3567 FitnessBrowser__acidovorax_3H11:Ac3H11_3567
MDRRSIIKHAGIAGVLAAGAAPAVHAQAAIRWRLASSFPKSLDTIYGGADVFSKAVKAMS
GGKFEISVHAGGELMPPFGVMDGVQQGTVEMCHTVPYYFYGKNPAFALGSAIPFGFNARQ
MNAWMLHGNGRKLMNEFYANYNAISFAGGNTGTQMGGWYRKEIKSPADFKGMKMRLGGGL
VGEVMQKLGAVPQSIPGGEIYQALEKGTLDAAEWVGPYDDQKLGFNKVAPFYYYPGWWEG
GPEVDFFVNQKAFDGLSAENKAIIEAATNVAHIDMLAKYDALNPTALKQLVAAKTKVLPF
SQAVMDASFKASMEVFAENDAKSPEWKKIYADMRTFQRDQILWFRFAEARYDTFMSAQKV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory