SitesBLAST
Comparing Ac3H11_360 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
64% identity, 100% coverage: 2:260/260 of query aligns to 2:255/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), S14 (= S14), G15 (= G15), I16 (= I16), G35 (= G35), F36 (= F36), L60 (≠ M64), N86 (= N90), G88 (= G92), I89 (= I93), A137 (= A141), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), V184 (= V188), T186 (= T190)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
66% identity, 100% coverage: 2:260/260 of query aligns to 2:255/255 of 2q2qD
- active site: G15 (= G15), S138 (= S142), Y151 (= Y155), K155 (= K159), R196 (≠ K200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), S14 (= S14), G15 (= G15), I16 (= I16), F36 (= F36), D59 (= D63), L60 (≠ M64), N86 (= N90), G88 (= G92), L109 (≠ I113), I136 (≠ V140), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), W183 (= W187), V184 (= V188), T186 (= T190), L188 (= L192), V189 (= V193)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
60% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 2ztlA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), L200 (≠ K200)
- binding (3s)-3-hydroxybutanoic acid: Q94 (= Q94), S142 (= S142), H144 (= H144), K152 (= K152), Y155 (= Y155), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), G15 (= G15), I16 (= I16), F36 (= F36), L64 (≠ M64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ I113), Y155 (= Y155), K159 (= K159), P185 (= P185), W187 (= W187), V188 (= V188), T190 (= T190), V193 (= V193)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
60% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 1wmbA
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
55% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 5b4tA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ K200)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q94), S142 (= S142), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (= W187), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), G15 (= G15), I16 (= I16), F36 (= F36), D63 (= D63), L64 (≠ M64), N90 (= N90), G92 (= G92), L113 (≠ I113), I140 (≠ V140), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (= W187), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
55% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 3w8dA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ K200)
- binding methylmalonic acid: Q94 (= Q94), S142 (= S142), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (= W187), Q196 (= Q196), W257 (= W257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), S14 (= S14), G15 (= G15), I16 (= I16), F36 (= F36), A62 (= A62), D63 (= D63), L64 (≠ M64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ I113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (= W187), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
55% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 3vdrA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ K200)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q94), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (= W187), Q196 (= Q196), W257 (= W257)
- binding acetoacetic acid: Q94 (= Q94), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (= W187), Q196 (= Q196), W257 (= W257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), I16 (= I16), F36 (= F36), D63 (= D63), L64 (≠ M64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ I113), K159 (= K159), G186 (= G186), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G11), T13 (= T13), I16 (= I16), F36 (= F36), D63 (= D63), L64 (≠ M64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ I113), S142 (= S142), Y155 (= Y155), K159 (= K159), G186 (= G186), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
55% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 3vdqA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ K200)
- binding acetate ion: Q94 (= Q94), H144 (= H144), K152 (= K152), W187 (= W187), L192 (= L192), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), S14 (= S14), I16 (= I16), F36 (= F36), D63 (= D63), L64 (≠ M64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ I113), I140 (≠ V140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (= W187), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
56% identity, 100% coverage: 1:260/260 of query aligns to 1:236/236 of 1x1tA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding cacodylate ion: S142 (= S142), H144 (= H144), Y155 (= Y155), W187 (= W187), W233 (= W257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), S14 (= S14), G15 (= G15), I16 (= I16), G35 (= G35), F36 (= F36), D63 (= D63), L64 (≠ M64), N90 (= N90), G92 (= G92), L113 (≠ I113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), W187 (= W187), V188 (= V188), T190 (= T190)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
42% identity, 100% coverage: 1:260/260 of query aligns to 3:260/260 of 6zzqA
- active site: G17 (= G15), S142 (= S142), Y155 (= Y155)
- binding acetoacetic acid: Q94 (= Q94), S142 (= S142), K152 (= K152), Y155 (= Y155), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G13 (= G11), S16 (= S14), G17 (= G15), I18 (= I16), D37 (= D38), M38 (≠ V39), D63 (= D69), V64 (≠ I70), N90 (= N90), A91 (= A91), G92 (= G92), M140 (≠ V140), A141 (= A141), S142 (= S142), Y155 (= Y155), K159 (= K159), Y187 (≠ W187), V188 (= V188), T190 (= T190)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
42% identity, 100% coverage: 1:260/260 of query aligns to 4:261/261 of 6zzsD
- active site: G18 (= G15), S143 (= S142), Y156 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G14 (= G11), S17 (= S14), I19 (= I16), D38 (= D38), M39 (≠ V39), D64 (= D69), V65 (≠ I70), N91 (= N90), A92 (= A91), G93 (= G92), M141 (≠ V140), A142 (= A141), S143 (= S142), Y156 (= Y155), K160 (= K159), P186 (= P185), G187 (= G186), V189 (= V188), T191 (= T190), L193 (= L192)
- binding 3-oxidanylidenepentanoic acid: Q95 (= Q94), S143 (= S142), N145 (≠ H144), K153 (= K152), Y156 (= Y155), Q197 (= Q196)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 98% coverage: 2:257/260 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G15), S142 (= S142), Q152 (≠ K152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (≠ T13), R15 (≠ S14), G16 (= G15), I17 (= I16), N35 (= N34), Y36 (≠ G35), N37 (≠ F36), G38 (= G37), S39 (≠ G41), N63 (≠ D63), V64 (≠ M64), N90 (= N90), A91 (= A91), I93 (= I93), I113 (= I113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ V188), T190 (= T190)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 100% coverage: 1:259/260 of query aligns to 2:247/248 of 6ixmC
- active site: G16 (= G15), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), S15 (= S14), G16 (= G15), I17 (= I16), D36 (≠ G35), I37 (≠ F36), A61 (= A62), D62 (= D63), T63 (≠ M64), N89 (= N90), A90 (= A91), M140 (≠ V140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ G186), Y187 (≠ W187), I188 (≠ V188), L192 (= L192)
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
37% identity, 98% coverage: 2:257/260 of query aligns to 8:262/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G11), S20 (= S14), G21 (= G15), I22 (= I16), D41 (= D38), I42 (≠ V39), M66 (≠ Y59), D67 (= D63), V68 (≠ M64), N94 (= N90), A95 (= A91), G96 (= G92), M145 (≠ V140), S147 (= S142), Y160 (= Y155), K164 (= K159), P190 (= P185), F192 (≠ W187), V193 (= V188), T195 (= T190), L197 (= L192), V198 (= V193)
- binding 3-oxidanylidenepentanoic acid: Q98 (= Q94), S147 (= S142), H149 (= H144), K157 (= K152), Y160 (= Y155), F192 (≠ W187), Q201 (= Q196)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
37% identity, 98% coverage: 2:257/260 of query aligns to 8:262/265 of 6zzoC
- binding acetoacetic acid: Q98 (= Q94), H149 (= H144), K157 (= K152), F192 (≠ W187), Q201 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G17 (= G11), S20 (= S14), G21 (= G15), I22 (= I16), D41 (= D38), I42 (≠ V39), M66 (≠ Y59), D67 (= D63), V68 (≠ M64), N94 (= N90), A95 (= A91), G96 (= G92), M145 (≠ V140), Y160 (= Y155), K164 (= K159), P190 (= P185), F192 (≠ W187), V193 (= V188), T195 (= T190), L197 (= L192), V198 (= V193)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
36% identity, 97% coverage: 8:258/260 of query aligns to 5:243/244 of 1edoA
- active site: G12 (= G15), S138 (= S142), Y151 (= Y155), K155 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), S10 (≠ T13), R11 (≠ S14), I13 (= I16), N31 (= N34), Y32 (≠ F36), A33 (≠ G37), R34 (≠ D38), S35 (≠ V39), D59 (= D63), V60 (≠ M64), N86 (= N90), A87 (= A91), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), I184 (≠ V188), S186 (≠ T190), M188 (≠ L192)
3sjuA Hedamycin polyketide ketoreductase bound to NADPH (see paper)
35% identity, 97% coverage: 5:256/260 of query aligns to 1:251/255 of 3sjuA
- active site: G11 (= G15), S138 (= S142), Y151 (= Y155), K155 (= K159), Y196 (≠ K200)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G11), S10 (= S14), A31 (= A29), R32 (≠ N30), D33 (≠ I31), C56 (≠ A62), D57 (= D63), V58 (≠ M64), S84 (≠ N90), A85 (= A91), G86 (= G92), I136 (≠ V140), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), Y183 (≠ W187), V184 (= V188), T186 (= T190), M188 (≠ L192)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
38% identity, 100% coverage: 2:260/260 of query aligns to 5:249/249 of 3uf0A
- active site: G18 (= G15), S141 (= S142), V151 (≠ K152), Y154 (= Y155), K158 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G11), S17 (= S14), G18 (= G15), I19 (= I16), R39 (≠ D38), D63 (≠ Y59), L64 (≠ H60), N89 (= N90), G91 (= G92), I92 (= I93), I139 (≠ V140), A140 (= A141), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), V187 (= V188), T189 (= T190), N191 (≠ A202), T192 (≠ E203)
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
35% identity, 97% coverage: 5:256/260 of query aligns to 3:253/257 of 2rh4A
- active site: G13 (= G15), N110 (= N114), S140 (= S142), Y153 (= Y155), K157 (= K159), Y198 (≠ K200)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (≠ V143), Q145 (≠ V147), V147 (≠ S149), Y153 (= Y155), F185 (≠ W187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), T11 (= T13), S12 (= S14), G13 (= G15), I14 (= I16), A33 (≠ G35), R34 (≠ F36), G35 (= G37), C58 (≠ A58), D59 (= D63), V60 (≠ M64), N86 (= N90), G88 (= G92), S140 (= S142), Y153 (= Y155), K157 (= K159), P183 (= P185), G184 (= G186), V186 (= V188), T188 (= T190), M190 (≠ L192)
Sites not aligning to the query:
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
35% identity, 97% coverage: 5:256/260 of query aligns to 7:257/261 of P16544
- 11:39 (vs. 9:37, 48% identical) binding
- D63 (= D63) binding
- K161 (= K159) binding
Query Sequence
>Ac3H11_360 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)
MLKGKTALVTGSTSGIGLGIAKALARQGANIVLNGFGDVDGPRAEVLAAGAAAEVQVAYH
GADMSRAADIEDMMKSSAAQFGRVDILVNNAGIQHVANVEDFPVERWDSVIAINLTSAFH
TSRLALPAMKSANWGRIINVASVHGLVGSAQKAAYVAAKHGVVGLTKVTALENATTGVTC
NAICPGWVLTPLVQKQVDAKAAEHGLSNEDAKKLLLGEKEPSMQFTTPEELGELAVFFCS
PAANNVRGVAWNMDGGWAAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory