SitesBLAST
Comparing Ac3H11_3700 FitnessBrowser__acidovorax_3H11:Ac3H11_3700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 96% coverage: 33:750/750 of query aligns to 8:721/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M61), G39 (= G62), Q40 (= Q63), H41 (≠ G64), V42 (≠ T65), A45 (≠ G68), G79 (= G136), G80 (= G137), S81 (= S138), S83 (= S140), V84 (≠ I141), G374 (= G423), F375 (= F424), L379 (= L428), L499 (≠ W543), R500 (= R544), V624 (≠ I653), D625 (≠ N654), Q632 (= Q661), T687 (≠ E716), G688 (= G717), L689 (≠ V718), G690 (= G719), E691 (= E720)
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
26% identity, 39% coverage: 195:483/750 of query aligns to 516:829/1286 of 4yswA
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 848, 880, 881, 882, 885, 886, 889
- binding calcium ion: 838, 841, 842, 845, 878, 879
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 851, 885, 980, 981, 1050, 1232
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 39% coverage: 195:483/750 of query aligns to 545:858/1331 of P22985
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
26% identity, 39% coverage: 195:483/750 of query aligns to 516:829/1291 of 6a7xB
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 851, 885, 980, 981, 1049, 1050, 1232
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
26% identity, 39% coverage: 195:483/750 of query aligns to 518:831/1291 of 2e3tA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 882, 883, 887, 888, 891
- binding calcium ion: 840, 843, 844, 847, 880, 881
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 853, 887, 982, 983, 1051, 1052, 1234
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
26% identity, 39% coverage: 195:483/750 of query aligns to 518:831/1295 of 6a7xA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 853, 887, 982, 983, 1052, 1234
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 53% coverage: 180:579/750 of query aligns to 552:976/1361 of Q8GUQ8
- E831 (≠ R427) mutation to A: Loss of activity.
- R909 (= R500) mutation to A: Decreases activity 12-fold.
Sites not aligning to the query:
- 364 W→A: Decreases activity 8-fold.
- 421 Y→A: Decreases activity 4-fold.
- 1297 E→A: Decreases activity 40-fold.
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
27% identity, 48% coverage: 214:574/750 of query aligns to 14:380/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 48% coverage: 214:574/750 of query aligns to 14:380/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
24% identity, 49% coverage: 195:563/750 of query aligns to 546:932/1333 of P47989
- P555 (= P204) to S: in dbSNP:rs45577338
- D584 (≠ P228) to A: in dbSNP:rs45491693
- R607 (≠ V251) to Q: in dbSNP:rs45442092
- K617 (= K260) to N: in dbSNP:rs45442398
- T623 (≠ A266) to I: in dbSNP:rs45448694
- I646 (≠ G287) to V: in dbSNP:rs17323225
- I703 (≠ L333) to V: in dbSNP:rs17011368
- L763 (≠ V388) to F: in a breast cancer sample; somatic mutation
- R791 (≠ H416) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- T910 (≠ F542) to M: in dbSNP:rs669884
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
24% identity, 49% coverage: 195:563/750 of query aligns to 520:906/1307 of 2e1qA
- active site: Q742 (= Q393), V777 (≠ L428), R855 (= R500), H859 (≠ A517), R887 (= R544)
- binding bicarbonate ion: R814 (= R464), H815 (≠ P465), I852 (≠ V497), F886 (≠ W543), F889 (≠ V546), G890 (= G547), Q893 (≠ H550)
- binding calcium ion: E715 (≠ A368), H716 (= H369), Y718 (≠ A371), T741 (= T392), T747 (≠ A398), S780 (≠ V430), T781 (≠ D431), S784 (≠ A434), T811 (≠ D461), G812 (≠ F462)
- binding fe2/s2 (inorganic) cluster: L719 (= L372)
- binding hydroxy(dioxo)molybdenum: F773 (= F424), G774 (= G425), R887 (= R544)
Sites not aligning to the query:
- active site: 1235, 1236
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding hydroxy(dioxo)molybdenum: 1053, 1054, 1236
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
26% identity, 51% coverage: 218:599/750 of query aligns to 7:409/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
2ckjA Human milk xanthine oxidoreductase
24% identity, 46% coverage: 217:563/750 of query aligns to 516:875/1264 of 2ckjA
Sites not aligning to the query:
- active site: 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
26% identity, 35% coverage: 218:483/750 of query aligns to 537:822/1291 of 3amzA
Sites not aligning to the query:
- active site: 844, 848, 876, 1224, 1225
- binding bicarbonate ion: 873, 874, 878, 879, 882
- binding calcium ion: 831, 834, 835, 838, 871, 872
- binding flavin-adenine dinucleotide: 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 1,4-dihydronicotinamide adenine dinucleotide: 328, 329, 330, 365, 366, 402, 403, 430, 432, 433, 473, 480, 1189
- binding uric acid: 844, 878, 973, 974, 1043, 1225
3bdjA Crystal structure of bovine milk xanthine dehydrogenase with a covalently bound oxipurinol inhibitor (see paper)
26% identity, 35% coverage: 218:483/750 of query aligns to 535:820/1286 of 3bdjA
Sites not aligning to the query:
- active site: 842, 846, 874, 1222, 1223
- binding Oxypurinol: 842, 876, 971, 972, 1040, 1041, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148
- binding Oxo(sulfanyl)molybdenum(IV) ION: 872, 873, 874, 1223
1n5xA Xanthine dehydrogenase from bovine milk with inhibitor tei-6720 bound (see paper)
26% identity, 35% coverage: 218:483/750 of query aligns to 540:825/1290 of 1n5xA
Sites not aligning to the query:
- active site: 847, 851, 879, 1227, 1228
- binding flavin-adenine dinucleotide: 43, 44, 229, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 2-(3-cyano-4-isobutoxy-phenyl)-4-methyl-5-thiazole-carboxylic acid: 840, 847, 881, 976, 977, 978, 981
3am9A Complex of bovine xanthine dehydrogenase and trihydroxy fyx-051 (see paper)
26% identity, 35% coverage: 218:483/750 of query aligns to 539:824/1293 of 3am9A
- active site: Q733 (= Q393), E768 (≠ R427)
- binding bicarbonate ion: R805 (= R464), H806 (≠ P465)
- binding calcium ion: H707 (= H369), Y709 (≠ A371), T802 (≠ D461), G803 (≠ F462)
- binding fe2/s2 (inorganic) cluster: L710 (= L372)
- binding 4-[5-(2,6-dioxo-1,2,3,6-tetrahydropyridin-4-yl)-1H-1,2,4-triazol-3-yl]-6-oxo-1,6-dihydropyridine-2-carbonitrile: L614 (≠ G290), E768 (≠ R427)
Sites not aligning to the query:
- active site: 846, 850, 878, 1226, 1227
- binding bicarbonate ion: 875, 876, 877, 884
- binding calcium ion: 833, 836, 837, 840, 873, 874
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 231, 232, 233, 234, 235, 236, 309, 310, 314, 318, 319, 322, 323, 325, 326, 332, 376, 394
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 148
- binding 4-[5-(2,6-dioxo-1,2,3,6-tetrahydropyridin-4-yl)-1H-1,2,4-triazol-3-yl]-6-oxo-1,6-dihydropyridine-2-carbonitrile: 839, 842, 846, 880, 975, 980, 1045, 1227
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
26% identity, 35% coverage: 218:483/750 of query aligns to 535:820/1286 of 3unaA
Sites not aligning to the query:
- active site: 842, 846, 874, 1222, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 430, 431, 471, 478
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
26% identity, 35% coverage: 218:483/750 of query aligns to 539:824/1298 of 1v97A
Sites not aligning to the query:
- active site: 846, 850, 878, 1226, 1227
- binding calcium ion: 833, 836, 837, 840, 873, 874
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: 839, 846, 880, 975, 980, 1042, 1044, 1045, 1227
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
26% identity, 35% coverage: 218:483/750 of query aligns to 540:825/1299 of 1vdvA
Sites not aligning to the query:
- active site: 847, 851, 879, 1227, 1228
- binding calcium ion: 834, 837, 838, 841, 874, 875
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: 840, 843, 847, 881, 976, 977, 978, 981, 1043, 1046
Query Sequence
>Ac3H11_3700 FitnessBrowser__acidovorax_3H11:Ac3H11_3700
VLLGGAATAGALVIGWGVMPPRQRLHPADPLPATPGQAALNGWLKVGTDNTVTVMMAKSE
MGQGTHTGLAAILAEELDADWAQVRLAMAPIDDIYNNLATVVDGLPFHPDNDGSMKAVAG
WLTAKTMREVGVMMTGGSSSIKDLWLPMREAGAHARAMLVRAAAAQWKVQAAECTANAGW
VEHAAGRRATFGELAALAAQQPMPGKVVLKEPAQFKLIGKPLTRIEAPSKLDGSAVFGID
ANPPGLQHASVVMCPTRGGKVARFDAAAAQKLPGVKQVLAVAPYHGGTGGVAVIADTPWH
AKKAAAAVTVEWDHGPAATLSSDTVMARLTQALDETKGFGYHSAGDVDQAMQGAATSITA
DYRAPYLAHAALEPINCTVQVKDGGAQVWTSTQVPGLARMAAAKALGMDEEKVTVHQLLL
GGGFGRRLEVDYVAQAAAIAQAAGGAPVQTLWSREQDTQHDFYRPACMARFKAGFDAQGQ
LVAWHNLSVGQAIVPQVLARTFGLPGAGPDKTASEGAFDQPYEWPHARIAHEIIDLPLPV
GFWRSVGHSHQAFFKESFVDEAAHAAKKDPVAFRAALLQKHPRHLKVLQKAAELAGWGQP
LPPDALGVQRARGVALHQSFGSIVAQVAEVSVGADKAIRVHRVVCVIDCGAAINPNLIAQ
QMESAVVFGLTAALYGEVTFENGQVQQSNFHDVPLLRMADCPRVETHIIASAEPPEGVGE
PGVPPIAPAVANALFALTGQRLRALPLKLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory