SitesBLAST
Comparing Ac3H11_3725 FitnessBrowser__acidovorax_3H11:Ac3H11_3725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 77% coverage: 21:235/280 of query aligns to 15:226/378 of P69874
- C26 (≠ T32) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y33) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F52) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C61) mutation to T: Loss of ATPase activity and transport.
- L60 (= L67) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L83) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V142) mutation to M: Loss of ATPase activity and transport.
- D172 (= D179) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
1g291 Malk (see paper)
42% identity, 68% coverage: 39:228/280 of query aligns to 18:213/372 of 1g291
- binding magnesium ion: D69 (≠ Q90), E71 (≠ D92), K72 (≠ E93), K79 (vs. gap), D80 (≠ G95)
- binding pyrophosphate 2-: S38 (= S59), G39 (= G60), C40 (= C61), G41 (= G62), K42 (= K63), T43 (≠ S64), T44 (= T65)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
40% identity, 73% coverage: 24:228/280 of query aligns to 7:216/375 of 2d62A
8hprC Lpqy-sugabc in state 4 (see paper)
39% identity, 80% coverage: 31:254/280 of query aligns to 10:231/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y33), S38 (= S59), G39 (= G60), G41 (= G62), K42 (= K63), S43 (= S64), Q82 (= Q103), Q133 (≠ A154), G136 (= G157), G137 (= G158), Q138 (≠ M159), H192 (= H213)
- binding magnesium ion: S43 (= S64), Q82 (= Q103)
8hprD Lpqy-sugabc in state 4 (see paper)
39% identity, 80% coverage: 31:254/280 of query aligns to 10:231/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y33), S38 (= S59), C40 (= C61), G41 (= G62), K42 (= K63), S43 (= S64), T44 (= T65), Q82 (= Q103), R129 (≠ A150), Q133 (≠ A154), S135 (= S156), G136 (= G157), G137 (= G158), Q159 (≠ E180), H192 (= H213)
- binding magnesium ion: S43 (= S64), Q82 (= Q103)
8hplC Lpqy-sugabc in state 1 (see paper)
39% identity, 80% coverage: 31:254/280 of query aligns to 10:229/384 of 8hplC
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 71% coverage: 30:228/280 of query aligns to 10:208/393 of P9WQI3
- H193 (= H213) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 72% coverage: 37:237/280 of query aligns to 39:243/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
37% identity, 72% coverage: 37:237/280 of query aligns to 39:243/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
40% identity, 73% coverage: 24:228/280 of query aligns to 7:202/353 of 1vciA
7ahdC Opua (e190q) occluded (see paper)
36% identity, 72% coverage: 37:237/280 of query aligns to 39:243/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (= T37), S61 (= S59), G62 (= G60), G64 (= G62), K65 (= K63), S66 (= S64), T67 (= T65), Q111 (= Q103), K161 (≠ R153), Q162 (≠ A154), S164 (= S156), G166 (= G158), M167 (= M159), Q188 (≠ E180), H221 (= H213)
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
37% identity, 77% coverage: 43:258/280 of query aligns to 21:239/374 of 2awnB
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
37% identity, 77% coverage: 43:258/280 of query aligns to 22:240/371 of P68187
- A85 (≠ T106) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P127) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V135) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A138) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A140) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S145) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G158) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D179) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (vs. gap) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
37% identity, 77% coverage: 43:258/280 of query aligns to 19:237/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S59), G36 (= G60), C37 (= C61), G38 (= G62), K39 (= K63), S40 (= S64), T41 (= T65), R126 (≠ A150), A130 (= A154), S132 (= S156), G134 (= G158), Q135 (≠ M159)
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
37% identity, 77% coverage: 43:258/280 of query aligns to 21:239/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S59), G38 (= G60), C39 (= C61), G40 (= G62), K41 (= K63), S42 (= S64), T43 (= T65), Q81 (= Q103), R128 (≠ A150), A132 (= A154), S134 (= S156), G136 (= G158), Q137 (≠ M159), E158 (= E180), H191 (= H213)
- binding magnesium ion: S42 (= S64), Q81 (= Q103)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
37% identity, 77% coverage: 43:258/280 of query aligns to 21:239/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G60), C39 (= C61), G40 (= G62), K41 (= K63), S42 (= S64), T43 (= T65), R128 (≠ A150), S134 (= S156), Q137 (≠ M159)
- binding beryllium trifluoride ion: S37 (= S59), G38 (= G60), K41 (= K63), Q81 (= Q103), S134 (= S156), G136 (= G158), H191 (= H213)
- binding magnesium ion: S42 (= S64), Q81 (= Q103)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
37% identity, 77% coverage: 43:258/280 of query aligns to 21:239/371 of 3puwA
- binding adenosine-5'-diphosphate: G38 (= G60), C39 (= C61), G40 (= G62), K41 (= K63), S42 (= S64), T43 (= T65), R128 (≠ A150), A132 (= A154), S134 (= S156), Q137 (≠ M159)
- binding tetrafluoroaluminate ion: S37 (= S59), G38 (= G60), K41 (= K63), Q81 (= Q103), S134 (= S156), G135 (= G157), G136 (= G158), E158 (= E180), H191 (= H213)
- binding magnesium ion: S42 (= S64), Q81 (= Q103)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
37% identity, 77% coverage: 43:258/280 of query aligns to 21:239/371 of 3puvA
- binding adenosine-5'-diphosphate: G38 (= G60), C39 (= C61), G40 (= G62), K41 (= K63), S42 (= S64), T43 (= T65), R128 (≠ A150), A132 (= A154), S134 (= S156), Q137 (≠ M159)
- binding magnesium ion: S42 (= S64), Q81 (= Q103)
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 77% coverage: 43:258/280 of query aligns to 22:240/369 of P19566
- L86 (= L107) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P181) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D186) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
39% identity, 70% coverage: 31:227/280 of query aligns to 11:215/226 of 5xu1B
Query Sequence
>Ac3H11_3725 FitnessBrowser__acidovorax_3H11:Ac3H11_3725
MTSPAESPPLAHAQAPLPHSTPAVEVLSAEKTYPNGTQALLPVDLTIEEGEFVTLLGPSG
CGKSTLLKMVAGLLEPTDGRLHLWRKPVAQLDESGKKMAFVFQSPTLMPWASVQTNVRLP
LDLAGVPRAEADARVTEALALVGLSKFANALPRALSGGMQMRVSIARGLVTQPDLLLMDE
PFGALDEITRHKLDADLLDLWRKKKLTVIFVTHSIHEAVFLSSRVVMMAARPGRVVEEFR
IDAPYPRTADFMVSPEFSRYAKLLQDSLLRASVDTEETVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory