SitesBLAST
Comparing Ac3H11_3809 FitnessBrowser__acidovorax_3H11:Ac3H11_3809 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vw6B Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
57% identity, 90% coverage: 32:605/635 of query aligns to 21:555/560 of 7vw6B
- binding fe2/s2 (inorganic) cluster: C108 (= C122), T112 (≠ S126), C113 (= C127), C141 (= C158), L144 (≠ R161), C145 (= C162)
- binding flavin mononucleotide: G221 (= G267), G223 (= G269), K232 (= K278), N248 (= N294), D250 (= D296), Y324 (= Y374), G327 (= G377), E328 (= E378), N363 (≠ H413), N364 (= N414), T367 (= T417)
- binding iron/sulfur cluster: I325 (= I375), P343 (= P393), S496 (= S546), C497 (= C547), G498 (= G548), Q499 (= Q549), C500 (= C550), C503 (= C553), I536 (= I586), C537 (= C587), L539 (= L589), G540 (= G590)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
40% identity, 61% coverage: 222:607/635 of query aligns to 22:413/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G267), G67 (= G269), K76 (= K278), N92 (= N294), E95 (= E297), Y180 (= Y374), G183 (= G377), E184 (= E378), V218 (≠ E412), N219 (≠ H413), N220 (= N414), T223 (= T417)
- binding iron/sulfur cluster: T346 (≠ S546), C347 (= C547), G348 (= G548), Q349 (= Q549), C350 (= C550), C353 (= C553), S391 (= S585), I392 (= I586), C393 (= C587), G396 (= G590)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
40% identity, 61% coverage: 222:607/635 of query aligns to 21:412/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G267), G66 (= G269), K75 (= K278), N91 (= N294), D93 (= D296), E94 (= E297), G182 (= G377), E183 (= E378), E184 (= E379), V217 (≠ E412), N218 (≠ H413), N219 (= N414), T222 (= T417), G393 (= G588)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G269), G67 (= G270), A68 (= A271), F70 (= F273), K75 (= K278), E94 (= E297), E96 (= E299), Y179 (= Y374), E184 (= E379), Y204 (= Y399)
- binding iron/sulfur cluster: P198 (= P393), T345 (≠ S546), C346 (= C547), G347 (= G548), Q348 (= Q549), C349 (= C550), C352 (= C553), I391 (= I586), C392 (= C587), L394 (= L589), G395 (= G590)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
40% identity, 61% coverage: 222:607/635 of query aligns to 21:412/419 of 6saqB
- binding flavin mononucleotide: G64 (= G267), G66 (= G269), K75 (= K278), N91 (= N294), D93 (= D296), E94 (= E297), Y179 (= Y374), G182 (= G377), E183 (= E378), N218 (≠ H413), N219 (= N414), T222 (= T417)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G269), G67 (= G270), A68 (= A271), F70 (= F273), K75 (= K278), E94 (= E297), E96 (= E299), T99 (= T302), E184 (= E379), Y204 (= Y399), T318 (≠ S519)
- binding iron/sulfur cluster: P198 (= P393), T345 (≠ S546), C346 (= C547), G347 (= G548), Q348 (= Q549), C349 (= C550), C352 (= C553), I391 (= I586), C392 (= C587), G395 (= G590)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
40% identity, 61% coverage: 222:607/635 of query aligns to 20:411/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G267), G65 (= G269), K74 (= K278), N90 (= N294), D92 (= D296), E93 (= E297), G181 (= G377), E182 (= E378), E183 (= E379), V216 (≠ E412), N217 (≠ H413), N218 (= N414), T221 (= T417)
- binding nicotinamide-adenine-dinucleotide: G65 (= G269), G66 (= G270), A67 (= A271), F69 (= F273), K74 (= K278), E95 (= E299), Y178 (= Y374), E183 (= E379), K200 (≠ R396), Y203 (= Y399)
- binding iron/sulfur cluster: I179 (= I375), P197 (= P393), T344 (≠ S546), C345 (= C547), G346 (= G548), Q347 (= Q549), C348 (= C550), C351 (= C553), S389 (= S585), I390 (= I586), C391 (= C587), L393 (= L589), G394 (= G590)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
34% identity, 77% coverage: 118:607/635 of query aligns to 27:554/630 of 8a6tB
- binding fe2/s2 (inorganic) cluster: C31 (= C122), G33 (≠ S124), C36 (= C127), C82 (= C158), F85 (≠ R161), C86 (= C162)
- binding flavin mononucleotide: G201 (= G269), N227 (= N294), E230 (= E297), N355 (= N414), G535 (= G588), L536 (= L589)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E379), R337 (= R396), R340 (≠ Y399), T341 (≠ I400), N342 (≠ A401), S433 (= S492)
- binding iron/sulfur cluster: S487 (= S546), C488 (= C547), G489 (= G548), C491 (= C550), C494 (= C553), C534 (= C587), L536 (= L589), G537 (= G590)
- binding zinc ion: C471 (≠ R530)
Sites not aligning to the query:
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
39% identity, 60% coverage: 230:608/635 of query aligns to 22:419/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G267), G59 (= G269), K68 (= K278), N89 (= N294), D91 (= D296), E92 (= E297), G180 (= G377), E181 (= E378), E182 (= E379), T216 (≠ H413), N217 (= N414)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G269), G60 (= G270), F63 (= F273), K68 (= K278), E94 (= E299), Y177 (= Y374), E182 (= E379), F202 (≠ Y399), T324 (≠ S519)
- binding iron/sulfur cluster: P196 (= P393), S351 (= S546), C352 (= C547), G353 (= G548), Q354 (= Q549), C355 (= C550), C358 (= C553), T396 (≠ S585), C398 (= C587), L400 (= L589)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
39% identity, 60% coverage: 230:608/635 of query aligns to 23:420/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G269), K69 (= K278), N90 (= N294), D92 (= D296), E93 (= E297), G94 (= G298), Y178 (= Y374), G181 (= G377), E182 (= E378), N218 (= N414)
- binding iron/sulfur cluster: P197 (= P393), S352 (= S546), C353 (= C547), Q355 (= Q549), C356 (= C550), C359 (= C553), T397 (≠ S585), C399 (= C587)
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
39% identity, 58% coverage: 240:608/635 of query aligns to 45:428/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G267), G71 (= G269), K80 (= K278), N98 (= N294), D100 (= D296), G189 (= G377), E191 (= E379), N226 (= N414), A408 (≠ G588), L409 (= L589)
- binding iron/sulfur cluster: P205 (= P393), C361 (= C547), G362 (= G548), Q363 (= Q549), C364 (= C550), C367 (= C553), T405 (≠ S585), C407 (= C587), L409 (= L589)
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
39% identity, 58% coverage: 240:608/635 of query aligns to 43:426/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G267), G69 (= G269), K78 (= K278), N96 (= N294), D98 (= D296), E99 (= E297), G187 (= G377), E188 (= E378), N224 (= N414), A406 (≠ G588)
- binding iron/sulfur cluster: I185 (= I375), P203 (= P393), C359 (= C547), Q361 (= Q549), C362 (= C550), C365 (= C553), T403 (≠ S585), I404 (= I586), C405 (= C587), L407 (= L589)
- binding : Y143 (≠ H341), N144 (≠ G342), Q150 (= Q348), D174 (vs. gap)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
35% identity, 77% coverage: 116:607/635 of query aligns to 5:523/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C11 (= C122), C16 (= C127), C48 (= C158), F49 (≠ V159), L51 (≠ R161), C52 (= C162)
- binding flavin mononucleotide: G166 (= G267), G168 (= G269), N196 (= N294), D198 (= D296), F284 (≠ Y374), G287 (= G377), E288 (= E378), E289 (= E379), N324 (= N414)
- binding iron/sulfur cluster: C457 (= C547), G458 (= G548), K459 (≠ Q549), C460 (= C550), C463 (= C553), C503 (= C587), G506 (= G590)
- binding zinc ion: C440 (≠ R530)
Sites not aligning to the query:
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
8gymv1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (see paper)
40% identity, 58% coverage: 240:608/635 of query aligns to 34:418/442 of 8gymv1
- binding flavin mononucleotide: G58 (= G267), G60 (= G269), N88 (= N294), D90 (= D296), Y176 (= Y374), E180 (= E378), E181 (= E379), T215 (≠ H413), N216 (= N414), T219 (= T417), A398 (≠ G588), L399 (= L589)
- binding iron/sulfur cluster: I177 (= I375), P195 (= P393), C351 (= C547), G352 (= G548), Q353 (= Q549), C354 (= C550), C357 (= C553), T395 (≠ S585), C397 (= C587), L399 (= L589), G400 (= G590)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
39% identity, 58% coverage: 240:608/635 of query aligns to 35:421/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G267), G61 (= G269), K70 (= K278), N91 (= N294), D93 (= D296), G182 (= G377), E183 (= E378), E184 (= E379), A218 (≠ H413), N219 (= N414), A401 (≠ G588), L402 (= L589)
- binding iron/sulfur cluster: P198 (= P393), C354 (= C547), G355 (= G548), Q356 (= Q549), C357 (= C550), C360 (= C553), T398 (≠ S585), C400 (= C587), L402 (= L589)
7aqrF Cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) (see paper)
40% identity, 55% coverage: 253:604/635 of query aligns to 46:415/434 of 7aqrF
- binding flavin mononucleotide: G60 (= G267), R61 (≠ L268), G62 (= G269), K71 (= K278), N89 (= N294), D91 (= D296), Y177 (= Y374), G180 (= G377), E181 (= E378), E182 (= E379), T216 (≠ H413), N217 (= N414)
- binding iron/sulfur cluster: S351 (= S546), C352 (= C547), G353 (= G548), Q354 (= Q549), C355 (= C550), C358 (= C553), T396 (≠ S585), C398 (= C587), L400 (= L589)
P49821 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see paper)
39% identity, 58% coverage: 240:610/635 of query aligns to 63:448/464 of P49821
- C379 (= C547) binding
- C382 (= C550) binding
- C385 (= C553) binding
- C425 (= C587) binding
7v2cA Active state complex i from q10 dataset (see paper)
39% identity, 58% coverage: 240:610/635 of query aligns to 38:423/433 of 7v2cA
- binding flavin mononucleotide: G62 (= G267), K73 (= K278), N91 (= N294), Y179 (= Y374), G182 (= G377), E183 (= E378), N219 (= N414), A401 (≠ G588), L402 (= L589)
- binding iron/sulfur cluster: P198 (= P393), C354 (= C547), G355 (= G548), Q356 (= Q549), C357 (= C550), C360 (= C553), T398 (≠ S585), C400 (= C587), L402 (= L589)
Q91YT0 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see 2 papers)
39% identity, 58% coverage: 240:608/635 of query aligns to 63:446/464 of Q91YT0
- C379 (= C547) binding
- C382 (= C550) binding
- C385 (= C553) binding
- C425 (= C587) binding
Sites not aligning to the query:
- 1:20 modified: transit peptide, Mitochondrion
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
39% identity, 59% coverage: 231:604/635 of query aligns to 28:416/437 of 4hea1
- binding flavin mononucleotide: G63 (= G267), K74 (= K278), N91 (= N294), D93 (= D296), Y179 (= Y374), G182 (= G377), E183 (= E378), N218 (≠ H413), N219 (= N414), L401 (= L589)
- binding iron/sulfur cluster: I180 (= I375), P198 (= P393), S351 (= S546), C352 (= C547), G353 (= G548), K354 (≠ Q549), C355 (= C550), C358 (= C553), F398 (≠ I586), C399 (= C587), L401 (= L589)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
39% identity, 59% coverage: 231:604/635 of query aligns to 28:416/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G267), G65 (= G269), N91 (= N294), D93 (= D296), G182 (= G377), E183 (= E378), E184 (= E379), N218 (≠ H413), N219 (= N414), T222 (= T417), P400 (≠ G588)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G269), G66 (= G270), F69 (= F273), K74 (= K278), F77 (≠ I281), E96 (= E299), Y179 (= Y374), E184 (= E379), K201 (≠ R396), F204 (≠ Y399), T324 (≠ S519)
- binding iron/sulfur cluster: S351 (= S546), C352 (= C547), K354 (≠ Q549), C355 (= C550), C358 (= C553), F398 (≠ I586), C399 (= C587), L401 (= L589), A402 (≠ G590)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
39% identity, 59% coverage: 231:604/635 of query aligns to 29:417/438 of Q56222
Query Sequence
>Ac3H11_3809 FitnessBrowser__acidovorax_3H11:Ac3H11_3809
MHLAPEAPPATVVAAVSVNDMRERIRRKSRLKGRQPEDAAMADVAQLLGPRPATGFRRDL
LIEYLHRLNDHFGVLHDRHLVALAKQMNLPMAEVYEVASFYHHFEIVRGDDAQAPRLVLR
VCDSLSCSLAGARELLAALPERLRAAGQGDVQVLAVPCVGRCEQAPVAVVHQCPVPRATV
DTVLEVVESKPKRALARHPQALKAINFDVAALAEKSIPTSLREVSPAHTDLATYRAHGGY
QTAAALVNGEMDAEAVLAAMEDSGLRGLGGAGFPAGRKWRIVRDQPAPRLMAVNIDEGEP
GTFKDRTYLERDPHRFLEGVLIAAQVVGTEAIYIYLRDEYHGCRVLLQQALDDLRAEPPC
PLPHIELRRGAGAYICGEESAMIESIEGKRGEPRMRPPYIAQVGLFGRPTLEHNFETLYW
VRDIVERGPQWFASFGRHGRKGLRSFSVSGRVKHPGVKLAPAGITVQELIDEYCGGLLDG
HQLYAYLPGGASGGILPASLNQIPLDFDTLQPYGCFIGSAAVIVLSQHDRARDAALNVMR
FFEHESCGQCTPCRVGTAKAATLMEAPQWDGDLLDDLAQVMGDASICGLGQAAPNPIRCI
HKYFPHEVGEGSWPGDQPKPRNSPLAEQLPAGGKP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory