SitesBLAST
Comparing Ac3H11_3828 FitnessBrowser__acidovorax_3H11:Ac3H11_3828 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
37% identity, 91% coverage: 12:418/445 of query aligns to 5:421/448 of 3du4A
- active site: F17 (≠ C24), Y146 (= Y152), E217 (= E224), D251 (= D258), A254 (= A261), K280 (= K287), A417 (≠ Y414)
- binding 7-keto-8-aminopelargonic acid: L82 (≠ A90), Y146 (= Y152), G315 (≠ S321), S317 (= S323), R410 (= R407)
- binding pyridoxal-5'-phosphate: S112 (≠ D118), G113 (= G119), A114 (= A120), Y146 (= Y152), H147 (= H153), E217 (= E224), D251 (= D258), V253 (≠ I260), A254 (= A261), K280 (= K287), H316 (= H322), S317 (= S323)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
37% identity, 91% coverage: 12:418/445 of query aligns to 5:421/448 of P53555
- GA 113:114 (= GA 119:120) binding
- Y146 (= Y152) binding
- K280 (= K287) modified: N6-(pyridoxal phosphate)lysine
- G315 (≠ S321) binding
- HS 316:317 (= HS 322:323) binding
- R410 (= R407) binding
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
33% identity, 96% coverage: 20:444/445 of query aligns to 14:420/420 of 6erkA
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
37% identity, 96% coverage: 20:444/445 of query aligns to 13:424/429 of 6ed7A
- active site: Y17 (≠ C24), Y144 (= Y152), D245 (= D258), K274 (= K287)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ C24), W52 (= W61), W52 (= W61), Y144 (= Y152), D147 (≠ E155), A217 (= A230), K274 (= K287), R391 (= R407), F393 (≠ I409), F393 (≠ I409)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), D245 (= D258), I247 (= I260), K274 (= K287)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
37% identity, 96% coverage: 20:444/445 of query aligns to 13:424/429 of P12995
- Y17 (≠ C24) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W61) binding
- GS 112:113 (≠ GA 119:120) binding
- Y144 (= Y152) mutation to F: Severely reduces the aminotransferase activity.
- D147 (≠ E155) mutation to N: Loss of aminotransferase activity.
- D245 (= D258) binding
- R253 (= R266) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K287) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (≠ S321) binding
- PT 308:309 (≠ HS 322:323) binding
- R391 (= R407) binding ; mutation to A: Reduces aminotransferase activity.
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
37% identity, 96% coverage: 20:444/445 of query aligns to 13:424/429 of 1dtyA
- active site: Y17 (≠ C24), Y144 (= Y152), E211 (= E224), D245 (= D258), A248 (= A261), K274 (= K287), Y398 (= Y414)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), D245 (= D258), I247 (= I260), K274 (= K287)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
37% identity, 96% coverage: 20:444/445 of query aligns to 13:423/427 of 1mlzA
- active site: Y17 (≠ C24), Y144 (= Y152), E210 (= E224), D244 (= D258), A247 (= A261), K273 (= K287), Y397 (= Y414)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), D244 (= D258), I246 (= I260), K273 (= K287), P307 (≠ H322), T308 (≠ S323)
- binding trans-amiclenomycin: W52 (= W61), W53 (= W62), Y144 (= Y152), K273 (= K287), R390 (= R407), F392 (≠ I409)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
37% identity, 96% coverage: 20:444/445 of query aligns to 13:423/427 of 1mlyA
- active site: Y17 (≠ C24), Y144 (= Y152), E210 (= E224), D244 (= D258), A247 (= A261), K273 (= K287), Y397 (= Y414)
- binding cis-amiclenomycin: W52 (= W61), W53 (= W62), K273 (= K287), R390 (= R407), F392 (≠ I409)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), D244 (= D258), I246 (= I260), K273 (= K287), P307 (≠ H322), T308 (≠ S323)
6wnnA Bacillus subtilis bioa in complex with amino donor l-lys
35% identity, 91% coverage: 12:418/445 of query aligns to 2:393/420 of 6wnnA
- active site: F14 (≠ C24), Y143 (= Y152), D223 (= D258), K252 (= K287)
- binding (2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid: F14 (≠ C24), W51 (= W62), S109 (≠ D118), G110 (= G119), A111 (= A120), Y143 (= Y152), H144 (= H153), D223 (= D258), V225 (≠ I260), K252 (= K287), R382 (= R407)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: H288 (= H322), S289 (= S323)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
36% identity, 96% coverage: 20:444/445 of query aligns to 13:412/416 of 1qj3A
- active site: Y17 (≠ C24), Y144 (= Y152), E201 (= E224), D235 (= D258), A238 (= A261), K264 (= K287), Y386 (= Y414)
- binding 7-keto-8-aminopelargonic acid: Y17 (≠ C24), W52 (= W61), Y144 (= Y152), K264 (= K287), R379 (= R407), F381 (≠ I409)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), G146 (= G154), D235 (= D258), I237 (= I260), A238 (= A261), K264 (= K287)
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
38% identity, 93% coverage: 7:420/445 of query aligns to 1:405/427 of 4cxqA
- active site: Y18 (≠ C24), Y149 (= Y152), E212 (= E224), D246 (= D258), A249 (= A261), K275 (= K287), Y399 (= Y414)
- binding 7-keto-8-aminopelargonic acid: W56 (= W61), Y149 (= Y152), G308 (≠ S321), T310 (≠ S323), R392 (= R407)
- binding pyridoxal-5'-phosphate: G116 (= G119), S117 (≠ A120), Y149 (= Y152), H150 (= H153), G151 (= G154), E212 (= E224), D246 (= D258), I248 (= I260), K275 (= K287), P309 (≠ H322), T310 (≠ S323)
3tfuA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, post-reaction complex with a 3,6- dihydropyrid-2-one heterocycle inhibitor (see paper)
37% identity, 93% coverage: 7:420/445 of query aligns to 2:397/417 of 3tfuA
- active site: Y19 (≠ C24), Y151 (= Y152), E204 (= E224), D238 (= D258), A241 (= A261), K267 (= K287), Y391 (= Y414)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-2-oxo-1,2-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: W58 (= W61), G118 (= G119), S119 (≠ A120), Y151 (= Y152), H152 (= H153), D238 (= D258), I240 (= I260), K267 (= K287), P301 (≠ H322), T302 (≠ S323)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
38% identity, 93% coverage: 7:420/445 of query aligns to 1:403/425 of 4w1vA
- active site: Y18 (≠ C24), Y147 (= Y152), E210 (= E224), D244 (= D258), A247 (= A261), K273 (= K287), Y397 (= Y414)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P23), Y18 (≠ C24), W54 (= W61), M81 (= M88), G83 (≠ A90), Y147 (= Y152), G306 (≠ S321), P307 (≠ H322), T308 (≠ S323), F392 (≠ I409)
- binding pyridoxal-5'-phosphate: G114 (= G119), S115 (≠ A120), Y147 (= Y152), H148 (= H153), E210 (= E224), D244 (= D258), I246 (= I260), K273 (= K287)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
38% identity, 93% coverage: 7:420/445 of query aligns to 1:403/425 of 4cxrA
- active site: Y18 (≠ C24), Y147 (= Y152), E210 (= E224), D244 (= D258), A247 (= A261), K273 (= K287), Y397 (= Y414)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ C24), W54 (= W61), W55 (= W62), A216 (= A230)
- binding pyridoxal-5'-phosphate: G114 (= G119), S115 (≠ A120), Y147 (= Y152), H148 (= H153), E210 (= E224), D244 (= D258), I246 (= I260), K273 (= K287), P307 (≠ H322), T308 (≠ S323)
6ge8B Crystal structure of mycobacterium tuberculosis bioa
38% identity, 93% coverage: 7:420/445 of query aligns to 2:399/420 of 6ge8B
- binding [(2~{S})-3-(1~{H}-indol-3-yl)-1-[(2~{E})-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene]hydrazinyl]-1-oxidanylidene-propan-2-yl]azanium: W58 (= W61), G118 (= G119), S119 (≠ A120), Y151 (= Y152), H152 (= H153), A212 (= A230), D240 (= D258), I242 (= I260), K269 (= K287), P303 (≠ H322), T304 (≠ S323)
- binding magnesium ion: H152 (= H153), G153 (= G154), A158 (= A159), C162 (≠ T163)
3dodA Crystal structure of plp bound 7,8-diaminopelargonic acid synthase in bacillus subtilis (see paper)
34% identity, 91% coverage: 12:418/445 of query aligns to 3:390/417 of 3dodA
- active site: F15 (≠ C24), E186 (= E224), D220 (= D258), A223 (= A261), K249 (= K287), A386 (≠ Y414)
- binding pyridoxal-5'-phosphate: W52 (= W62), S110 (≠ D118), G111 (= G119), A112 (= A120), D220 (= D258), V222 (≠ I260), K249 (= K287), H285 (= H322), S286 (= S323)
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 94% coverage: 2:420/445 of query aligns to 3:413/437 of P9WQ81
- Y25 (≠ C24) mutation to A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
- W64 (= W61) binding
- Y157 (= Y152) binding
- K283 (= K287) modified: N6-(pyridoxal phosphate)lysine
- G316 (≠ S321) binding
6ge8A Crystal structure of mycobacterium tuberculosis bioa
37% identity, 93% coverage: 7:420/445 of query aligns to 2:401/422 of 6ge8A
- binding [(2~{S})-3-(1~{H}-indol-3-yl)-1-[(2~{E})-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene]hydrazinyl]-1-oxidanylidene-propan-2-yl]azanium: Y19 (≠ C24), W58 (= W61), G118 (= G119), S119 (≠ A120), Y151 (= Y152), H152 (= H153), E208 (= E224), D242 (= D258), I244 (= I260), K271 (= K287), P305 (≠ H322), T306 (≠ S323)
5te2A Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a mechanism-based inhibitor (see paper)
38% identity, 93% coverage: 7:420/445 of query aligns to 1:406/428 of 5te2A
- active site: Y18 (≠ C24), Y150 (= Y152), E213 (= E224), D247 (= D258), A250 (= A261), K276 (= K287), Y400 (= Y414)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-4-oxo-1,4-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: Y18 (≠ C24), W57 (= W61), G117 (= G119), S118 (≠ A120), Y150 (= Y152), H151 (= H153), G152 (= G154), D247 (= D258), I249 (= I260), K276 (= K287), G309 (≠ S321), P310 (≠ H322), T311 (≠ S323)
4xjoA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
38% identity, 93% coverage: 7:420/445 of query aligns to 1:406/428 of 4xjoA
- active site: Y18 (≠ C24), Y150 (= Y152), E213 (= E224), D247 (= D258), A250 (= A261), K276 (= K287), Y400 (= Y414)
- binding 5-[4-(3-chlorobenzoyl)piperazin-1-yl]-1H-inden-1-one: P17 (= P23), Y18 (≠ C24), W57 (= W61), M84 (= M88), G86 (≠ A90), Y150 (= Y152), G165 (≠ A173), G166 (≠ P174), A219 (= A230), P310 (≠ H322), T311 (≠ S323)
- binding pyridoxal-5'-phosphate: G117 (= G119), S118 (≠ A120), Y150 (= Y152), H151 (= H153), G152 (= G154), E213 (= E224), D247 (= D258), I249 (= I260), K276 (= K287), P310 (≠ H322), T311 (≠ S323)
Query Sequence
>Ac3H11_3828 FitnessBrowser__acidovorax_3H11:Ac3H11_3828
MSASAHLAPDALAARSLASVWHPCTQMKRHEAQPPVAIARAQGPWLIDTDGKRYLDGISS
WWVNLFGHSHPHIQAALVDQLGKLDHVMLAGFTHAPVVELSERLAALTGLGHAFYGSDGA
AATEIALKMSAHYWRNTGRPAKSHFVGLAGGYHGETVGALAVTDIAIFREAYAPLVRLAD
TVPSPDARSAAPGEAAQDVARRAAAALEAWLQEHHTTTAAFIVEPLVQCAAGMAMHDPEY
LRLARALCNRYEVHLVVDEIAVGFGRTGTMFAHQQAGIRPDFICLSKGLTGGTLPLSAVL
TTDAVYAAFYDDDVARGFLHSHSYTGNPLACRAALATLELFDQLDALNANRALAQHIDTA
CAPLTQHPRVRHARRLGMIWAWDVDTTLPDFSRRYHQHAMARGLVLRPIGKTLYAMPPYV
LDNEAVQCLAGGALDALNATLQEEI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory