Comparing Ac3H11_3836 FitnessBrowser__acidovorax_3H11:Ac3H11_3836 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
36% identity, 45% coverage: 120:393/610 of query aligns to 184:439/453 of P05041
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
37% identity, 51% coverage: 91:401/610 of query aligns to 377:667/673 of 8hx8A
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
39% identity, 43% coverage: 130:393/610 of query aligns to 370:619/632 of 8hx9A
Sites not aligning to the query:
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
35% identity, 45% coverage: 129:400/610 of query aligns to 202:454/470 of P28820
7pi1DDD Aminodeoxychorismate synthase component 1
35% identity, 45% coverage: 129:400/610 of query aligns to 195:447/459 of 7pi1DDD
Sites not aligning to the query:
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
34% identity, 45% coverage: 120:393/610 of query aligns to 182:423/437 of 1k0eA
Sites not aligning to the query:
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 60% coverage: 34:397/610 of query aligns to 140:466/489 of O94582
Sites not aligning to the query:
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
31% identity, 45% coverage: 120:393/610 of query aligns to 184:406/420 of 1k0gA
Sites not aligning to the query:
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 48% coverage: 123:413/610 of query aligns to 285:572/577 of Q94GF1
1k0gB The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
31% identity, 45% coverage: 120:393/610 of query aligns to 184:403/415 of 1k0gB
Sites not aligning to the query:
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 35% coverage: 187:397/610 of query aligns to 315:507/524 of A0QX93
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 35% coverage: 129:344/610 of query aligns to 309:520/595 of P32068
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
31% identity, 44% coverage: 129:397/610 of query aligns to 230:486/505 of 5cwaA
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
32% identity, 45% coverage: 129:404/610 of query aligns to 241:505/512 of 1i1qA
Sites not aligning to the query:
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
32% identity, 45% coverage: 129:404/610 of query aligns to 245:509/520 of P00898
Sites not aligning to the query:
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
34% identity, 35% coverage: 187:397/610 of query aligns to 294:482/499 of 7bvdA
Sites not aligning to the query:
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
30% identity, 45% coverage: 129:404/610 of query aligns to 236:500/511 of 1i7sA
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
30% identity, 45% coverage: 129:404/610 of query aligns to 242:506/517 of 1i7qA
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
30% identity, 45% coverage: 129:404/610 of query aligns to 244:508/519 of P00897
Sites not aligning to the query:
P9WFX1 Salicylate synthase; Chorismate mutase; CM; Isochorismate synthase/isochorismate lyase; Mycobactin synthase protein; EC 5.4.99.5; EC 4.2.99.21; EC 5.4.4.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
30% identity, 27% coverage: 181:345/610 of query aligns to 239:400/450 of P9WFX1
Sites not aligning to the query:
>Ac3H11_3836 FitnessBrowser__acidovorax_3H11:Ac3H11_3836
MPTGQAPGAFLFVISRIDFTQPLDPGAPRLRHVFGTPREVLAAHALHEVRGVLDAVHAAA
QQGRWCVGCVRYEAAAAFDAALLTHAADGPLAWFAVYDAPLPWPACDDGQGAEPPAQVTW
TDSPDRAPFDAALAQIQQAIAAGELYQVNHTAPLHGTLQGAAPALFAALLRAQPGGYAAH
IDTGGEQVLSVSPELFFDWRDAPGGGHILARPMKGTAPRGATPEEDAQQAVHLRTAPKER
AENVMIVDLLRNDVSRIAQPHSVRVPVLFATQALPTVWQMTSDVTARTRPGTTLTDVFAA
LFPCGSVTGAPKVRAMQMIHALEGAPRGVYCGAVGVVRPAGPPDAQGQHAVAATFNVPIR
TVVLRPEGGTVHATCGIGSGITSGALADAEWSEWQHKRAFVERASQPFDLLETLALQAGV
FRHRDEHLARLQSAAAHFGVPWDAAAVSQCLQALAADHADGAWRVRLLLGATGTPRAEAL
ALLPTAEPVRLQLATRPLAQAHSEFVRYKTTRRAHYAAFAPTTPGVFDTLLWNEAGEITE
STFGNIAALIDGRWVTPPLSCGLLPGVGRAVALREGRVVEAVLRVADVPRVQGWAFINSL
RGWLAATLEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory