SitesBLAST
Comparing Ac3H11_3916 FitnessBrowser__acidovorax_3H11:Ac3H11_3916 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
32% identity, 70% coverage: 145:493/499 of query aligns to 44:396/404 of 3wx9A
- binding 2-oxoglutaric acid: D213 (= D311), P214 (≠ V312), Y215 (≠ F313), G216 (= G314), E217 (≠ D315), G241 (= G339), T242 (≠ S340), I246 (≠ S344)
- binding (2E)-pent-2-enedioic acid: Y130 (= Y231), N184 (= N282), R376 (= R473)
- binding glutamic acid: L131 (≠ F232), V360 (≠ T457), A364 (≠ L461), R369 (≠ A466)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G205), S105 (= S206), Q106 (≠ T207), Y130 (= Y231), N184 (= N282), D212 (= D310), P214 (≠ V312), Y215 (≠ F313), T242 (≠ S340), S244 (= S342), K245 (= K343), R252 (= R350)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
32% identity, 70% coverage: 145:493/499 of query aligns to 44:396/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ F232), Q135 (= Q236), A364 (≠ L461), R369 (≠ A466)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y130 (= Y231), L131 (≠ F232), A132 (≠ G233), N184 (= N282), R376 (= R473)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G205), S105 (= S206), Q106 (≠ T207), Y130 (= Y231), V179 (≠ M277), N184 (= N282), D212 (= D310), P214 (≠ V312), Y215 (≠ F313), T242 (≠ S340), S244 (= S342), K245 (= K343), R252 (= R350)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
32% identity, 70% coverage: 145:493/499 of query aligns to 44:396/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y171), Y130 (= Y231), L275 (= L372)
- binding pyridoxal-5'-phosphate: G104 (= G205), S105 (= S206), Q106 (≠ T207), Y130 (= Y231), V179 (≠ M277), N184 (= N282), D212 (= D310), P214 (≠ V312), Y215 (≠ F313), T242 (≠ S340), S244 (= S342), K245 (= K343), R252 (= R350)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
32% identity, 70% coverage: 145:493/499 of query aligns to 44:396/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G205), S105 (= S206), Q106 (≠ T207), Y130 (= Y231), V179 (≠ M277), N184 (= N282), D212 (= D310), P214 (≠ V312), Y215 (≠ F313), T242 (≠ S340), S244 (= S342), K245 (= K343), R252 (= R350)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
31% identity, 70% coverage: 144:493/499 of query aligns to 40:394/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G205), S103 (= S206), Q104 (≠ T207), Y128 (= Y231), V177 (≠ M277), N182 (= N282), D210 (= D310), P212 (≠ V312), Y213 (≠ F313), T240 (≠ S340), S242 (= S342), K243 (= K343), R250 (= R350)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
28% identity, 70% coverage: 145:494/499 of query aligns to 46:400/405 of 2zc0A
- active site: Y132 (= Y231), D214 (= D310), A216 (≠ V312), S246 (= S342)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G205), G107 (≠ S206), T108 (= T207), Y132 (= Y231), N186 (= N282), D214 (= D310), A216 (≠ V312), Y217 (≠ F313), T244 (≠ S340), S246 (= S342), K247 (= K343), R254 (= R350)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
29% identity, 75% coverage: 124:498/499 of query aligns to 13:385/389 of 2z1yA
- binding leucine: G32 (≠ A143), Y117 (= Y231), R360 (= R473)
- binding pyridoxal-5'-phosphate: G91 (= G205), S92 (= S206), Q93 (≠ T207), Y117 (= Y231), N166 (= N282), D194 (= D310), Y197 (≠ F313), S227 (= S340), S229 (= S342), K230 (= K343), R237 (= R350)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
29% identity, 74% coverage: 130:498/499 of query aligns to 25:389/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G35 (≠ L140), G36 (≠ A141), G95 (= G205), S96 (= S206), Q97 (≠ T207), Y121 (= Y231), N170 (= N282), D198 (= D310), Y201 (≠ F313), S231 (= S340), S233 (= S342), K234 (= K343), R241 (= R350), R364 (= R473)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
29% identity, 74% coverage: 130:498/499 of query aligns to 25:389/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G205), S96 (= S206), Q97 (≠ T207), Y121 (= Y231), N170 (= N282), D198 (= D310), A200 (≠ V312), Y201 (≠ F313), S231 (= S340), S233 (= S342), K234 (= K343), R241 (= R350)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
29% identity, 74% coverage: 130:498/499 of query aligns to 29:393/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G39 (≠ L140), G40 (≠ A141), G99 (= G205), S100 (= S206), Q101 (≠ T207), Y125 (= Y231), N174 (= N282), D202 (= D310), Y205 (≠ F313), S235 (= S340), S237 (= S342), K238 (= K343), R245 (= R350), R368 (= R473)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
29% identity, 74% coverage: 130:498/499 of query aligns to 29:393/397 of Q72LL6
- G40 (≠ A141) binding
- Y70 (= Y171) binding
- N174 (= N282) binding ; binding
- R245 (= R350) binding
- R368 (= R473) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
25% identity, 70% coverage: 145:495/499 of query aligns to 50:410/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G205), S113 (= S206), Q114 (≠ T207), Y138 (= Y231), N194 (= N282), D222 (= D310), P224 (≠ V312), Y225 (≠ F313), T252 (≠ S340), S254 (= S342), K255 (= K343), R262 (= R350)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
31% identity, 60% coverage: 192:491/499 of query aligns to 79:383/388 of 8tn3A
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
30% identity, 72% coverage: 138:494/499 of query aligns to 28:367/368 of 1v2fA
- active site: F112 (≠ Y231), A181 (≠ V300), A183 (≠ Q302), K222 (= K343)
- binding hydrocinnamic acid: Q32 (≠ N142), G33 (≠ A143), Y57 (= Y171), F112 (≠ Y231), F253 (≠ L372), R347 (= R473)
- binding pyridoxal-5'-phosphate: G86 (= G205), A87 (≠ S206), T88 (= T207), F112 (≠ Y231), N163 (= N282), D191 (= D310), V193 (= V312), Y194 (≠ F313), S219 (= S340), K222 (= K343), R230 (= R350)
Sites not aligning to the query:
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
30% identity, 72% coverage: 138:494/499 of query aligns to 28:367/368 of 1v2eA
- active site: F112 (≠ Y231), A181 (≠ V300), A183 (≠ Q302), K222 (= K343)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: Q32 (≠ N142), G33 (≠ A143), F112 (≠ Y231), K222 (= K343), F309 (≠ W431), R347 (= R473)
- binding pyridoxal-5'-phosphate: G86 (= G205), A87 (≠ S206), T88 (= T207), F112 (≠ Y231), D191 (= D310), V193 (= V312), Y194 (≠ F313), S219 (= S340), K222 (= K343), R230 (= R350)
Sites not aligning to the query:
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
25% identity, 59% coverage: 199:494/499 of query aligns to 110:420/425 of 5tf5A
Sites not aligning to the query:
2xh1A Crystal structure of human kat ii-inhibitor complex (see paper)
25% identity, 59% coverage: 199:494/499 of query aligns to 97:407/412 of 2xh1A
- binding (3s)-10-(4-aminopiperazin-1-yl)-9-fluoro-7-hydroxy-3-methyl-2,3-dihydro-8h-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylate: L280 (= L366)
- binding pyridoxal-5'-phosphate: S104 (= S206), Q105 (≠ T207), Y129 (= Y231), D217 (= D310), P219 (≠ V312), S247 (= S340), S249 (= S342), R257 (= R350)
Sites not aligning to the query:
2r2nA The crystal structure of human kynurenine aminotransferase ii in complex with kynurenine (see paper)
25% identity, 59% coverage: 199:494/499 of query aligns to 110:420/425 of 2r2nA
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y142 (= Y231), R399 (= R473)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S117 (= S206), Q118 (≠ T207), Y142 (= Y231), N202 (= N282), D230 (= D310), P232 (≠ V312), Y233 (≠ F313), S260 (= S340), S262 (= S342), K263 (= K343), R270 (= R350)
Sites not aligning to the query:
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
25% identity, 59% coverage: 199:494/499 of query aligns to 99:409/414 of 2vgzA
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
25% identity, 59% coverage: 199:494/499 of query aligns to 113:423/428 of 6t8qA
Query Sequence
>Ac3H11_3916 FitnessBrowser__acidovorax_3H11:Ac3H11_3916
MAPSTSVLQHSYLQLAQQVRRDITLKRYAPGERLPSVRALAAAQGVSVATVVRCYRHLEA
LGVVQARHKSGMYVAEPAPVRAAPGAKDGADPSGGPGLQARARPAVPPPVEFDRLVSLEH
RMTQLYALTTQQPLQWGLHLANAAPAWYPTEALARIAQRLLRSQPEMLGTYPTGSGLPAL
RTELAGWMATYGLDLQPDELLVTNGSTEALNVALRAVTRPGDAVVVESPVYFGLLQMLGN
LGLRAIELPCTPGEGMSLEALEYALEHQSGVRAVVAMPNFQNPLGHVMPDRNKRRLLRLV
EQHDLALIEDDVFGDLSHTPHRPQPVKAWDRHGRVIYCGSSSKSLAPAFRLGWTSGGRWH
ARMESLKLSTSLAAPWLEQAVMAEFMRSGGLQPHLRRLRERLAQTTPRAAEAVRKHFPAG
TRVHSPAGGWWLWLQLPEPVDSLALLQRAVAQGMAFTPGALFSTSAKYASYLRLNIARPW
TRELEQAVRQLGQLAAGVP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory