Comparing Ac3H11_3931 FitnessBrowser__acidovorax_3H11:Ac3H11_3931 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
37% identity, 92% coverage: 6:186/196 of query aligns to 5:182/188 of 8gxkB
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
35% identity, 92% coverage: 6:186/196 of query aligns to 5:182/187 of 1yreB
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
32% identity, 93% coverage: 5:186/196 of query aligns to 4:182/187 of 8gxfB
>Ac3H11_3931 FitnessBrowser__acidovorax_3H11:Ac3H11_3931
MAFVEPITLRDRGVRLEPLALSHEEGLRLAAADGELWKLRVTSVPEPQDTRAYIETALAT
RDRFAFAVVDEATNAVLGSTSYHDILPAARRVEIGYTWYRQSVQRSHVNTTCKLLMMGHA
FDTLGCHVVGWRTDNYNFASQKAIERLGAKKDGVIRGHALRRDGTIRDTVMYSMRTGEWP
EARAQLLYLLERNKPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory