Comparing Ac3H11_3957 FitnessBrowser__acidovorax_3H11:Ac3H11_3957 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
65% identity, 91% coverage: 32:329/329 of query aligns to 3:299/306 of 4xfeA
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
52% identity, 91% coverage: 31:329/329 of query aligns to 3:301/301 of 4x04A
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
44% identity, 91% coverage: 30:329/329 of query aligns to 4:304/304 of 4x8rA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
47% identity, 90% coverage: 32:326/329 of query aligns to 3:298/300 of 4n8yA
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
40% identity, 87% coverage: 36:321/329 of query aligns to 7:291/303 of 4p3lA
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
40% identity, 92% coverage: 28:329/329 of query aligns to 29:327/330 of Q128M1
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
40% identity, 91% coverage: 32:329/329 of query aligns to 3:297/302 of 4mijA
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
40% identity, 91% coverage: 32:329/329 of query aligns to 3:297/301 of 4mhfA
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
39% identity, 90% coverage: 33:327/329 of query aligns to 4:297/298 of 4ovrA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
36% identity, 99% coverage: 3:329/329 of query aligns to 5:328/328 of Q0B2F6
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
39% identity, 85% coverage: 36:314/329 of query aligns to 6:283/300 of 4pf8A
4ovqA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d- glucuronate (see paper)
39% identity, 90% coverage: 33:329/329 of query aligns to 4:299/302 of 4ovqA
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
38% identity, 86% coverage: 31:314/329 of query aligns to 2:285/301 of 4n17A
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
38% identity, 86% coverage: 31:314/329 of query aligns to 2:285/301 of 4n15A
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
35% identity, 91% coverage: 31:329/329 of query aligns to 3:301/303 of 4pddA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
38% identity, 83% coverage: 46:318/329 of query aligns to 18:289/301 of 4pdhA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
37% identity, 83% coverage: 46:318/329 of query aligns to 21:292/304 of 4pakA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
37% identity, 83% coverage: 46:318/329 of query aligns to 20:291/303 of 4p9kA
Sites not aligning to the query:
4n91A Crystal structure of a trap periplasmic solute binding protein from anaerococcus prevotii dsm 20548 (apre_1383), target efi-510023, with bound alpha/beta d-glucuronate (see paper)
36% identity, 76% coverage: 62:310/329 of query aligns to 34:281/308 of 4n91A
Sites not aligning to the query:
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
36% identity, 81% coverage: 49:314/329 of query aligns to 21:284/301 of 4nq8B
Sites not aligning to the query:
>Ac3H11_3957 FitnessBrowser__acidovorax_3H11:Ac3H11_3957
MTFRRSLLTACAAAVAAMAMLPVAARAQSMVLKAADVHPAGYPNVVAVENMGKKLDAATN
GRLKIQTFPGGVLGGEKEMIEQTQFGAINILRTSLGPVGTVVPEVNVFNMPFVFRSQDHM
RAVIDGAIGDELLAKISASPAKLVAIGWMDGGSRSLYTKKPVRSPADLKGQKVRMMGNPL
FVDTMNAMGGNGISMGYGEVFTALQTGVVDGAENNAPSFFTSNHYSTGAKFYTQTNHLII
PELLVVSKVTWDKLSKDDQALLKKFGREAQLEQRALWDKSVEDYTAKLKAAGVEFINVDT
KAFYDATAPVRAKYGANYADLMKRIEAVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory