SitesBLAST
Comparing Ac3H11_3958 FitnessBrowser__acidovorax_3H11:Ac3H11_3958 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
51% identity, 88% coverage: 37:299/299 of query aligns to 2:264/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S109), S110 (= S145), N111 (= N146), H112 (= H147), Y135 (= Y170), S164 (= S199), R173 (= R208), F257 (= F292)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G44), G12 (= G47), Q13 (≠ G48), L14 (= L49), D33 (= D68), L34 (≠ I69), D50 (≠ R85), L51 (= L86), L70 (= L105), G71 (= G106), G72 (= G107), S74 (= S109), A108 (= A143), S110 (= S145), Y135 (= Y170), K139 (= K174), I162 (= I197), S164 (= S199), C165 (≠ S200)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
51% identity, 88% coverage: 37:299/299 of query aligns to 1:263/265 of Q7CRQ0
- Y134 (= Y170) mutation to A: 0.1% of wild-type activity.
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
50% identity, 88% coverage: 37:299/299 of query aligns to 2:264/265 of 3rfxA
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
35% identity, 53% coverage: 40:197/299 of query aligns to 2:159/321 of 4id9A
- active site: S106 (= S145), Y132 (= Y170), K136 (= K174)
- binding nicotinamide-adenine-dinucleotide: G9 (= G47), R10 (≠ G48), V11 (≠ L49), D30 (= D68), L31 (= L72), R32 (≠ G73), S44 (≠ R85), L45 (= L86), L64 (= L105), A66 (≠ G107), V81 (≠ A120), S106 (= S145), Y132 (= Y170), K136 (= K174), F159 (≠ I197)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
35% identity, 53% coverage: 40:197/299 of query aligns to 3:160/328 of 4id9B
- active site: S107 (= S145), Y133 (= Y170), K137 (= K174)
- binding nicotinamide-adenine-dinucleotide: G10 (= G47), R11 (≠ G48), V12 (≠ L49), D31 (= D68), L32 (= L72), S45 (≠ R85), L46 (= L86), L65 (= L105), A67 (≠ G107), V82 (≠ A120), Y133 (= Y170), K137 (= K174), F160 (≠ I197)
Sites not aligning to the query:
3aw9A Structure of udp-galactose 4-epimerase mutant
32% identity, 53% coverage: 38:196/299 of query aligns to 1:157/304 of 3aw9A
- active site: A105 (= A143), S107 (= S145), S108 (≠ N146), T109 (≠ H147), Y131 (= Y170), K135 (= K174)
- binding galactose-uridine-5'-diphosphate: P69 (≠ S109), V71 (≠ E111), S107 (= S145), Y131 (= Y170)
- binding nicotinamide-adenine-dinucleotide: G7 (= G44), G10 (= G47), F11 (≠ G48), I12 (≠ L49), D31 (= D68), I32 (= I69), R46 (≠ A84), D47 (≠ R85), L48 (= L86), F65 (≠ L105), A66 (≠ G106), A67 (≠ G107), E82 (≠ A120), A105 (= A143), S106 (= S144), Y131 (= Y170), K135 (= K174)
Sites not aligning to the query:
- active site: 166, 169
- binding galactose-uridine-5'-diphosphate: 160, 168, 170, 173, 188, 193, 195, 197, 234, 263, 266
- binding nicotinamide-adenine-dinucleotide: 158, 160, 161, 168
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
32% identity, 55% coverage: 38:201/299 of query aligns to 1:174/307 of 6wjaA
- active site: A118 (≠ S145), A119 (≠ N146), A120 (≠ H147), F143 (≠ Y170), K147 (= K174)
- binding nicotinamide-adenine-dinucleotide: G7 (= G44), G10 (= G47), F11 (≠ G48), I12 (≠ L49), D31 (= D68), D32 (vs. gap), S34 (vs. gap), T35 (vs. gap), G36 (vs. gap), A55 (≠ L86), L74 (= L105), A75 (≠ G106), A76 (≠ G107), S93 (≠ A120), F143 (≠ Y170), K147 (= K174), F170 (≠ I197), F171 (≠ G198), I173 (≠ S200)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ E111), A120 (≠ H147), N172 (≠ S199)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
32% identity, 55% coverage: 38:201/299 of query aligns to 2:175/308 of 6wj9B
- active site: A119 (≠ S145), A120 (≠ N146), A121 (≠ H147), F144 (≠ Y170), K148 (= K174)
- binding nicotinamide-adenine-dinucleotide: G8 (= G44), G11 (= G47), F12 (≠ G48), I13 (≠ L49), D32 (= D68), D33 (vs. gap), S35 (vs. gap), T36 (vs. gap), G37 (vs. gap), D55 (≠ R85), A56 (≠ L86), L75 (= L105), A76 (≠ G106), A77 (≠ G107), S94 (≠ A120), A117 (= A143), A119 (≠ S145), F144 (≠ Y170), K148 (= K174), F171 (≠ I197), F172 (≠ G198), I174 (≠ S200)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ E111), N173 (≠ S199)
Sites not aligning to the query:
2c59A Gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), with gdp-alpha- d-mannose and gdp-beta-l-galactose bound in the active site. (see paper)
29% identity, 54% coverage: 39:198/299 of query aligns to 18:188/364 of 2c59A
- active site: S132 (= S145), A133 (≠ N146), C134 (≠ H147), Y163 (= Y170), K167 (= K174)
- binding guanosine-5'-diphosphate-beta-l-galactose: M91 (vs. gap), G92 (= G106), G93 (= G107), M94 (≠ V108), S132 (= S145), C134 (≠ H147)
- binding guanosine-5'-diphosphate-alpha-d-mannose: G92 (= G106), M94 (≠ V108), I97 (≠ E111), S132 (= S145), C134 (≠ H147), Y163 (= Y170)
- binding nicotinamide-adenine-dinucleotide: G23 (= G44), G26 (= G47), F27 (≠ G48), I28 (≠ L49), D47 (≠ R65), W48 (≠ L66), K49 (≠ S67), D67 (≠ R85), L68 (= L86), L87 (= L105), A89 (vs. gap), M91 (vs. gap), I111 (≠ V125), A130 (= A143), S132 (= S145), Y163 (= Y170), K167 (= K174)
Sites not aligning to the query:
- active site: 206
- binding guanosine-5'-diphosphate-beta-l-galactose: 191, 192, 206, 207, 210, 211, 214, 225, 230, 232, 266, 289, 290, 345
- binding guanosine-5'-diphosphate-alpha-d-mannose: 192, 206, 207, 210, 211, 214, 225, 230, 232, 266, 289, 290, 295, 345
- binding nicotinamide-adenine-dinucleotide: 190, 192, 193, 206
Q93VR3 GDP-mannose 3,5-epimerase; GDP-Man 3,5-epimerase; EC 5.1.3.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 55% coverage: 34:198/299 of query aligns to 24:199/377 of Q93VR3
- 34:60 (vs. 44:67, 26% identical) binding
- D58 (≠ R65) binding
- D78 (≠ R85) binding
- C145 (≠ H147) mutation to A: Loss of activity.; mutation to S: Strong reduction of activity.
- Y174 (= Y170) binding ; mutation to F: Loss of activity.
- K178 (= K174) binding ; mutation to R: Strong reduction of activity.
Sites not aligning to the query:
- 217 K→A: Loss of activity.
- 306 R→A: Strong reduction of activity.
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
29% identity, 53% coverage: 40:196/299 of query aligns to 2:163/311 of 3a4vA
- active site: T112 (≠ S145), Y137 (= Y170), K141 (= K174)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A46), G9 (= G47), Q10 (≠ G48), I11 (≠ L49), D32 (= D68), I33 (= I69), L46 (≠ A84), D47 (≠ R85), V48 (≠ L86), L69 (= L105), A70 (≠ G106), G71 (= G107), L73 (vs. gap), P110 (≠ A143), S111 (= S144), T112 (≠ S145), Y137 (= Y170), K141 (= K174)
- binding pyruvic acid: S74 (= S109), Y137 (= Y170)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
29% identity, 53% coverage: 40:196/299 of query aligns to 2:163/315 of 3a1nA
- active site: T112 (≠ S145), Y137 (= Y170), K141 (= K174)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A46), G9 (= G47), Q10 (≠ G48), I11 (≠ L49), D32 (= D68), I33 (= I69), L46 (≠ A84), D47 (≠ R85), L69 (= L105), A70 (≠ G106), G71 (= G107), L73 (vs. gap), S111 (= S144), Y137 (= Y170), K141 (= K174)
Sites not aligning to the query:
2c54A Gdp-mannose-3', 5' -epimerase (arabidopsis thaliana),k178r, with gdp- beta-l-gulose and gdp-4-keto-beta-l-gulose bound in active site. (see paper)
29% identity, 54% coverage: 39:198/299 of query aligns to 17:187/362 of 2c54A
- active site: S131 (= S145), A132 (≠ N146), C133 (≠ H147), Y162 (= Y170), R166 (≠ K174)
- binding guanosine 5'-diphosphate-4-keto-beta-l-gulose: G91 (= G106), G92 (= G107), M93 (≠ V108), S131 (= S145)
- binding guanosine 5'-diphosphate-beta-l-gulose: G91 (= G106), G92 (= G107), M93 (≠ V108), S131 (= S145), C133 (≠ H147), Y162 (= Y170)
- binding nicotinamide-adenine-dinucleotide: G22 (= G44), G25 (= G47), F26 (≠ G48), I27 (≠ L49), D46 (≠ R65), W47 (≠ L66), K48 (≠ S67), V65 (≠ A84), D66 (≠ R85), L67 (= L86), L86 (= L105), A88 (vs. gap), M90 (vs. gap), I110 (≠ V125), A129 (= A143), S131 (= S145), Y162 (= Y170), R166 (≠ K174)
Sites not aligning to the query:
- active site: 205
- binding guanosine 5'-diphosphate-4-keto-beta-l-gulose: 190, 191, 205, 206, 209, 210, 213, 224, 229, 231, 265, 288, 289, 344
- binding guanosine 5'-diphosphate-beta-l-gulose: 190, 191, 205, 206, 209, 210, 213, 224, 229, 231, 265, 288, 289, 344
- binding nicotinamide-adenine-dinucleotide: 189, 191, 192, 205
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
30% identity, 53% coverage: 39:197/299 of query aligns to 3:177/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G44), G11 (= G47), F12 (≠ G48), I13 (≠ L49), D32 (≠ A70), N33 (= N71), N35 (≠ G73), Y38 (≠ A77), K43 (≠ R82), D61 (vs. gap), L62 (vs. gap), L83 (= L105), A84 (≠ G106), A85 (vs. gap), A123 (= A143), Y150 (= Y170), K154 (= K174), F177 (≠ I197)
Sites not aligning to the query:
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
29% identity, 53% coverage: 40:196/299 of query aligns to 2:163/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A46), G9 (= G47), Q10 (≠ G48), I11 (≠ L49), D32 (= D68), I33 (= I69), L46 (≠ A84), D47 (≠ R85), V48 (≠ L86), L69 (= L105), A70 (≠ G106), L73 (vs. gap), V87 (≠ A120), P110 (≠ A143), S111 (= S144), K141 (= K174)
- binding threonine: S74 (= S109), T112 (≠ S145), F137 (≠ Y170)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
29% identity, 53% coverage: 40:196/299 of query aligns to 2:163/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A46), G9 (= G47), Q10 (≠ G48), I11 (≠ L49), D32 (= D68), I33 (= I69), L46 (≠ A84), D47 (≠ R85), V48 (≠ L86), L69 (= L105), A70 (≠ G106), G71 (= G107), L73 (vs. gap), P110 (≠ A143), S111 (= S144), T112 (≠ S145), F137 (≠ Y170), K141 (= K174)
- binding (3R)-3-hydroxy-L-norvaline: S74 (= S109), T112 (≠ S145), I113 (≠ N146), F137 (≠ Y170)
Sites not aligning to the query:
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
28% identity, 55% coverage: 39:201/299 of query aligns to 3:176/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G44), G11 (= G47), F12 (≠ G48), I13 (≠ L49), D32 (≠ A70), N33 (= N71), N35 (≠ G73), Y38 (≠ A77), K43 (≠ R82), D61 (vs. gap), L62 (vs. gap), L83 (= L105), A84 (≠ G106), A85 (≠ G107), A118 (= A143), Y145 (= Y170), K149 (= K174), F172 (≠ I197), F173 (≠ G198), T174 (≠ S199), V175 (≠ S200)
Sites not aligning to the query:
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
27% identity, 54% coverage: 40:199/299 of query aligns to 2:164/290 of 3eheA
- active site: T111 (≠ S145), S112 (≠ N146), T113 (≠ H147), Y135 (= Y170), K139 (= K174)
- binding nicotinamide-adenine-dinucleotide: G6 (= G44), G9 (= G47), F10 (≠ G48), I11 (≠ L49), D29 (≠ S67), N30 (≠ D68), L31 (≠ I69), S32 (≠ A70), S33 (≠ N71), G34 (≠ L72), D49 (≠ E87), L50 (vs. gap), I68 (≠ L105), A69 (≠ G106), A70 (≠ G107), T109 (≠ A143), Y135 (= Y170), K139 (= K174), F162 (≠ I197), A163 (≠ G198), N164 (≠ S199)
Sites not aligning to the query:
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
27% identity, 70% coverage: 39:247/299 of query aligns to 2:217/322 of 1r6dA
- active site: T127 (≠ S145), N128 (= N146), Q129 (≠ H147), Y151 (= Y170), K155 (= K174)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S109), H88 (vs. gap), T127 (≠ S145), N128 (= N146), Q129 (≠ H147), Y151 (= Y170), N180 (≠ A211), K190 (≠ R221), L191 (= L222), P206 (vs. gap), Y208 (= Y238), R215 (≠ T245)
- binding nicotinamide-adenine-dinucleotide: G10 (= G47), F11 (≠ G48), I12 (≠ L49), D37 (vs. gap), S38 (≠ T62), L39 (≠ T63), T40 (≠ L64), A42 (≠ L66), G43 (≠ S67), D63 (≠ R85), I64 (≠ L86), F83 (≠ L105), A84 (≠ G106), A85 (≠ G107), S87 (= S109), T102 (≠ A120), V125 (≠ A143), S126 (= S144), Y151 (= Y170), K155 (= K174), N181 (≠ T212)
Sites not aligning to the query:
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
28% identity, 53% coverage: 38:196/299 of query aligns to 1:165/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G44), G10 (= G47), Q11 (≠ G48), I12 (≠ L49), D33 (= D68), I34 (= I69), R35 (vs. gap), L48 (= L81), D49 (≠ R82), V50 (≠ L86), A72 (≠ G106), A73 (≠ G107), L75 (vs. gap), P112 (≠ A143), S114 (= S145), Y139 (= Y170), K143 (= K174)
Sites not aligning to the query:
Query Sequence
>Ac3H11_3958 FitnessBrowser__acidovorax_3H11:Ac3H11_3958
LHFVVRQLMTFNKCASTVPRTSAFVTAMPCHPTPLRFQRLLLTGAAGGLGQELRTRLKAY
CTTLRLSDIANLGDEGAGEELRPARLEDAGAVLGLLEGVDAVVHLGGVSTEQPWEPILQA
NIVGVYNLYEAARKQGVKRVVFASSNHVTGFYRQDEVVGLRDPARPDGLYGVSKAFGEDL
SRFYFDRYGIETVCLRIGSSFPEPRNRRMLATWMSYDDLERLVVASLTAPVVGHSIIYGM
GDNTTTWWDNTLARHIGYRPEDSSEPFRAKVEVADPHPDLTDPAVIYQGGPFVHTGPFE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory