Comparing Ac3H11_4130 FitnessBrowser__acidovorax_3H11:Ac3H11_4130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P00926 D-serine dehydratase; D-serine deaminase; DSD; EC 4.3.1.18 from Escherichia coli (strain K12) (see paper)
48% identity, 93% coverage: 26:443/450 of query aligns to 27:442/442 of P00926
3ss7X Crystal structure of holo d-serine dehydratase from escherichia coli at 1.55 a resolution (see paper)
48% identity, 93% coverage: 26:443/450 of query aligns to 22:437/437 of 3ss7X
3r0xA Crystal structure of selenomethionine incorporated apo d-serine deaminase from salmonella tyhimurium (see paper)
45% identity, 96% coverage: 8:441/450 of query aligns to 12:438/438 of 3r0xA
5ygrD Crystal structure of plp bound diaminopropionate ammonia lyase from salmonella typhimurium (see paper)
23% identity, 65% coverage: 81:374/450 of query aligns to 35:317/388 of 5ygrD
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
25% identity, 58% coverage: 131:391/450 of query aligns to 38:281/320 of 6zspAAA
Sites not aligning to the query:
>Ac3H11_4130 FitnessBrowser__acidovorax_3H11:Ac3H11_4130
MTIAEPQPAIDALLATRLRNAQPALWTNPARQAQPAAALPALGRTISLDDTHAAAARLAR
FAGLLAQVFPELAATGGVVESPLLPAAALAPALGMAEAQGSLFIKADHSLPVAGSIKARG
GMHEVLEFAEGLALQHGLVQPGGDYRALATPQAREVLGRYQVAVGSTGNLGMSIGVVASA
LGFQATVHMSADAKEWKKDRLRQRGVLVVEHTGDYERAVAAGRAEAASNPLCHFVDDEQS
FSLLLGYSAAALHLQKQLAEQGVAVDAEHPLIVYLPCGVGGAPAGITFGLRQVLGPHVHC
FFAEPVQSPCFLVQMMAGQGEHPSVYDWGLTNRTEADGLAVPRASLLAAELMQPLLSGVF
TVADDTLFAHLVRVLDALGERIEPSAAAGFSGPALLTGTTAGQAWLRSTGIDAVLHQATH
LVWTTGGLLVPDAQYQGFVQRGRAVLTAQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory