Comparing Ac3H11_4133 FitnessBrowser__acidovorax_3H11:Ac3H11_4133 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
40% identity, 91% coverage: 22:335/346 of query aligns to 12:322/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
39% identity, 87% coverage: 22:323/346 of query aligns to 12:282/287 of 3v0sA
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
32% identity, 88% coverage: 22:325/346 of query aligns to 11:311/311 of 1pz0A
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 90% coverage: 22:334/346 of query aligns to 8:325/333 of O14295
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 87% coverage: 22:323/346 of query aligns to 12:310/310 of P46336
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
34% identity, 92% coverage: 1:319/346 of query aligns to 6:286/286 of 8hnqA
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
31% identity, 86% coverage: 26:322/346 of query aligns to 16:310/331 of P80874
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
34% identity, 88% coverage: 22:327/346 of query aligns to 2:297/301 of 6ow0B
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
31% identity, 86% coverage: 26:322/346 of query aligns to 16:310/333 of 1pz1A
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
33% identity, 88% coverage: 22:327/346 of query aligns to 2:321/323 of 6ow0A
8hw0A The structure of akr6d1
31% identity, 86% coverage: 26:321/346 of query aligns to 6:318/329 of 8hw0A
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
28% identity, 89% coverage: 14:321/346 of query aligns to 3:274/275 of 6kiyA
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
28% identity, 89% coverage: 14:321/346 of query aligns to 3:274/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
28% identity, 89% coverage: 14:321/346 of query aligns to 2:273/274 of 5danA
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
29% identity, 88% coverage: 17:319/346 of query aligns to 5:325/326 of P77256
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
30% identity, 86% coverage: 30:327/346 of query aligns to 27:326/335 of 4aubB
Sites not aligning to the query:
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 89% coverage: 22:329/346 of query aligns to 18:349/351 of Q9P7U2
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
31% identity, 90% coverage: 31:342/346 of query aligns to 29:306/312 of 3erpA
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
31% identity, 90% coverage: 31:342/346 of query aligns to 30:311/315 of 5t79A
3n6qD Crystal structure of yghz from e. Coli (see paper)
28% identity, 86% coverage: 30:327/346 of query aligns to 28:313/315 of 3n6qD
>Ac3H11_4133 FitnessBrowser__acidovorax_3H11:Ac3H11_4133
MAEPNNPSNNTHPLPRPLGQRQVHPLGLGCMGMSEFYGQTDDAQSLATLHMAHGLGVNHF
DTADAYGFGHNESLLGRFLHELSPGQRAEVTVATKFGIVREPGRYERRIDNSPAYIRQAC
DASLQRLGVERIDLYYCHRRDPAVPLEDLMGTLADLVRAGKIAAVGLSEVSAESLRTAHA
LHPVAAVQSEYSLWERGAEQAVLPTAQALGIAFVAYSPLGRAFLTDQPPVLDALAPDDFR
RALPRFNGAEGQANRSLQQGLAQLAQSAGLPVTTLALAWMLNRHPHVLPIPGTRRSQHLQ
QNLAAAQATLPAEVMDALDALFAPGQVAGARYTEAGWVGIEASATA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory