Comparing Ac3H11_4136 FitnessBrowser__acidovorax_3H11:Ac3H11_4136 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
54% identity, 98% coverage: 2:277/281 of query aligns to 7:277/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
54% identity, 98% coverage: 2:277/281 of query aligns to 7:277/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
45% identity, 77% coverage: 63:279/281 of query aligns to 62:276/279 of 6v77B
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
38% identity, 97% coverage: 1:273/281 of query aligns to 2:269/277 of 6iymA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
42% identity, 78% coverage: 62:279/281 of query aligns to 54:248/252 of 3qdfA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
38% identity, 86% coverage: 37:279/281 of query aligns to 38:277/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
38% identity, 86% coverage: 37:279/281 of query aligns to 38:277/280 of 6j5xA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
44% identity, 63% coverage: 73:248/281 of query aligns to 14:191/216 of 6sbiA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
35% identity, 89% coverage: 24:273/281 of query aligns to 30:255/265 of 3r6oA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
44% identity, 63% coverage: 73:248/281 of query aligns to 20:197/224 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
44% identity, 63% coverage: 73:248/281 of query aligns to 15:192/218 of 6fogA
Sites not aligning to the query:
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
38% identity, 75% coverage: 62:272/281 of query aligns to 83:295/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
38% identity, 75% coverage: 62:272/281 of query aligns to 82:294/303 of 8skyB
1gttA Crystal structure of hpce (see paper)
39% identity, 63% coverage: 71:248/281 of query aligns to 223:392/421 of 1gttA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
37% identity, 75% coverage: 70:279/281 of query aligns to 23:231/233 of 6j5yA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
39% identity, 62% coverage: 72:246/281 of query aligns to 63:242/269 of 4dbhA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
35% identity, 78% coverage: 63:281/281 of query aligns to 69:263/264 of 6jvwB
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
36% identity, 64% coverage: 70:248/281 of query aligns to 15:197/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
32% identity, 68% coverage: 72:262/281 of query aligns to 10:216/247 of 1nkqA
2q1dX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate (see paper)
25% identity, 63% coverage: 95:272/281 of query aligns to 103:270/281 of 2q1dX
Sites not aligning to the query:
>Ac3H11_4136 FitnessBrowser__acidovorax_3H11:Ac3H11_4136
MKLIRYGQPGAERPGLLDATGTLRDLSMLLPDIGPAQLNPRTLSALAAIDASRLPPVYGT
PRLGSPVGGVGKIVCVGLNYADHAREAGLQPPAEPVLFMKAVTALSGPHDDVRIPAGAVK
TDWEVELGIVIGTRARNVAKAQALEHVAGYVLANDVSERAWQMERGGQWDKGKSHDTFAP
IGPWLVTADEVGDPHAIDLWLEVNGRRVQNGSTRNFIFDVPTVVSYISEFMTLESGDLVL
TGTPAGVGLGQKPAPWFLKPGDVMRLGATGLGEQVQKCVGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory