SitesBLAST
Comparing Ac3H11_417 FitnessBrowser__acidovorax_3H11:Ac3H11_417 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
26% identity, 98% coverage: 9:450/451 of query aligns to 11:470/478 of 3h0mA
- active site: K72 (= K69), S147 (= S152), S148 (= S153), S166 (= S171), T168 (= T173), G169 (= G174), G170 (= G175), S171 (= S176), Q174 (≠ I179)
- binding glutamine: M122 (≠ F120), G123 (vs. gap), D167 (= D172), T168 (= T173), G169 (= G174), G170 (= G175), S171 (= S176), F199 (≠ L204), Y302 (= Y292), R351 (= R321), D418 (≠ N395)
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
26% identity, 98% coverage: 9:450/451 of query aligns to 11:470/478 of 3h0lA
- active site: K72 (= K69), S147 (= S152), S148 (= S153), S166 (= S171), T168 (= T173), G169 (= G174), G170 (= G175), S171 (= S176), Q174 (≠ I179)
- binding asparagine: G123 (vs. gap), S147 (= S152), G169 (= G174), G170 (= G175), S171 (= S176), Y302 (= Y292), R351 (= R321), D418 (≠ N395)
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
27% identity, 89% coverage: 46:447/451 of query aligns to 182:589/616 of 6diiH
- binding methyl-9Z,12Z,15Z-octadecatrienylphosphonofluoridate: G255 (≠ A119), T258 (≠ G122), S281 (= S152), G302 (≠ T173), G303 (= G174), S305 (= S176), S472 (≠ R319), I532 (≠ F391), M539 (≠ L398)
Sites not aligning to the query:
Q7XJJ7 Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase; EC 3.5.1.99 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 89% coverage: 46:447/451 of query aligns to 182:589/607 of Q7XJJ7
- K205 (= K69) mutation to A: Loss of activity.
- SS 281:282 (= SS 152:153) mutation to AA: Loss of activity.
- GGGS 302:305 (≠ TGGS 173:176) binding
- S305 (= S176) mutation to A: Loss of activity.
- R307 (= R178) mutation to A: Loss of activity.
- S360 (vs. gap) mutation to A: No effect.
4gysB Granulibacter bethesdensis allophanate hydrolase co-crystallized with malonate (see paper)
30% identity, 90% coverage: 46:450/451 of query aligns to 50:442/461 of 4gysB
- active site: K72 (= K69), S146 (= S152), S147 (= S153), T165 (≠ S171), T167 (= T173), A168 (≠ G174), G169 (= G175), S170 (= S176), V173 (≠ I179)
- binding malonate ion: A120 (= A119), G122 (≠ S121), S146 (= S152), T167 (= T173), A168 (≠ G174), S170 (= S176), S193 (≠ T199), G194 (= G200), V195 (≠ A201), R200 (≠ T206), Y297 (≠ F294), R305 (vs. gap)
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
41% identity, 38% coverage: 60:231/451 of query aligns to 72:239/487 of 1m21A
- active site: K81 (= K69), S160 (= S152), S161 (= S153), T179 (≠ S171), T181 (= T173), D182 (≠ G174), G183 (= G175), S184 (= S176), C187 (≠ I179)
- binding : A129 (= A119), N130 (vs. gap), F131 (= F120), C158 (≠ G150), G159 (= G151), S160 (= S152), S184 (= S176), C187 (≠ I179), I212 (≠ L204)
Sites not aligning to the query:
Q9FR37 Amidase 1; AtAMI1; Translocon at the outer membrane of chloroplasts 64-I; AtTOC64-I; EC 3.5.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 81% coverage: 61:426/451 of query aligns to 28:402/425 of Q9FR37
- K36 (= K69) active site, Charge relay system; mutation to A: Loss of catalytic activity.; mutation to R: Reduces catalytic activity 10-fold.
- S113 (= S152) active site, Charge relay system; mutation S->A,T: Loss of catalytic activity.
- S114 (= S153) mutation to A: Loss of catalytic activity.; mutation to T: Reduces catalytic activity 400-fold.
- D133 (= D172) mutation to A: Loss of catalytic activity.; mutation to E: Reduces catalytic activity 600-fold.
- S137 (= S176) active site, Acyl-ester intermediate; mutation to A: Reduces catalytic activity 170-fold.; mutation to T: Loss of catalytic activity.
- C145 (≠ N184) mutation C->A,S: Reduces catalytic activity 10-fold.
- S214 (vs. gap) mutation to T: Slightly reduces catalytic activity.
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
25% identity, 86% coverage: 61:446/451 of query aligns to 71:473/485 of 2f2aA
- active site: K79 (= K69), S154 (≠ W135), S155 (≠ D136), S173 (= S171), T175 (= T173), G176 (= G174), G177 (= G175), S178 (= S176), Q181 (≠ I179)
- binding glutamine: G130 (≠ S121), S154 (≠ W135), D174 (= D172), T175 (= T173), G176 (= G174), S178 (= S176), F206 (≠ L204), Y309 (vs. gap), Y310 (vs. gap), R358 (= R321), D425 (≠ N395)
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
25% identity, 86% coverage: 61:446/451 of query aligns to 71:473/485 of 2dqnA
- active site: K79 (= K69), S154 (≠ W135), S155 (≠ D136), S173 (= S171), T175 (= T173), G176 (= G174), G177 (= G175), S178 (= S176), Q181 (≠ I179)
- binding asparagine: M129 (≠ F120), G130 (≠ S121), T175 (= T173), G176 (= G174), S178 (= S176), Y309 (vs. gap), Y310 (vs. gap), R358 (= R321), D425 (≠ N395)
6c6gA An unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. Inhibitor bound complex. (see paper)
32% identity, 69% coverage: 60:370/451 of query aligns to 65:380/457 of 6c6gA
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
29% identity, 90% coverage: 9:415/451 of query aligns to 11:421/457 of 5h6sC
- active site: K77 (= K69), S152 (= S152), S153 (= S153), L173 (≠ T173), G174 (= G174), G175 (= G175), S176 (= S176)
- binding 4-oxidanylbenzohydrazide: C126 (≠ A119), R128 (≠ S121), W129 (= W135), S152 (= S152), L173 (≠ T173), G174 (= G174), S176 (= S176), W306 (≠ G293), F338 (vs. gap)
3kfuE Crystal structure of the transamidosome (see paper)
31% identity, 91% coverage: 38:447/451 of query aligns to 39:455/468 of 3kfuE
Q84DC4 Mandelamide hydrolase; EC 3.5.1.86 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
33% identity, 51% coverage: 59:288/451 of query aligns to 90:314/507 of Q84DC4
- K100 (= K69) mutation to A: Abolishes activity on mandelamide.
- S180 (= S154) mutation to A: Significantly decreases activity on mandelamide.
- S181 (≠ G155) mutation to A: Significantly decreases activity on mandelamide.
- G202 (= G174) mutation to A: Increase in KM values for aromatic substrates, but not aliphatic substrates. Active against lactamide but not against mandelamide; when associated with H-207 and E-382.; mutation to V: Increase in KM values for aromatic substrates, but not aliphatic substrates.
- S204 (= S176) mutation to A: Abolishes activity on mandelamide.
- Q207 (≠ I179) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with E-382. Active against lactamide but not against mandelamide; when associated with A-202 and E-382. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with S-316 and N-437.
Sites not aligning to the query:
- 31 T→I: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with N-437.
- 316 S→N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-437.
- 382 Q→H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with H-207. Active against lactamide but not against mandelamide; when associated with A-202 and H-207.
- 437 I→N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with I-31. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-316.
3a1iA Crystal structure of rhodococcus sp. N-771 amidase complexed with benzamide (see paper)
28% identity, 86% coverage: 61:447/451 of query aligns to 87:498/508 of 3a1iA
- active site: K95 (= K69), S170 (= S152), S171 (= S153), G189 (≠ S171), Q191 (≠ T173), G192 (= G174), G193 (= G175), A194 (≠ S176), I197 (= I179)
- binding benzamide: F145 (= F120), S146 (= S121), G147 (= G122), Q191 (≠ T173), G192 (= G174), G193 (= G175), A194 (≠ S176), W327 (vs. gap)
Q936X2 Allophanate hydrolase; EC 3.5.1.54 from Pseudomonas sp. (strain ADP) (see paper)
29% identity, 87% coverage: 59:451/451 of query aligns to 81:467/605 of Q936X2
- K91 (= K69) mutation to A: Loss of activity.
- S165 (= S152) mutation to A: Loss of activity.
- S189 (= S176) mutation to A: Loss of activity.
1o9oA Crystal structure of the s131a mutant of malonamidase e2 complexed with malonamate from bradyrhizobium japonicum (see paper)
24% identity, 87% coverage: 60:451/451 of query aligns to 53:412/412 of 1o9oA
- active site: K62 (= K69), A131 (≠ W135), S132 (≠ D136), T150 (≠ S171), T152 (= T173), G153 (= G174), G154 (= G175), S155 (= S176), R158 (≠ I179)
- binding 3-amino-3-oxopropanoic acid: G130 (≠ A134), T152 (= T173), G153 (= G174), G154 (= G175), S155 (= S176), R158 (≠ I179), P359 (≠ G377)
1ocmA The crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum (see paper)
25% identity, 87% coverage: 60:451/451 of query aligns to 53:412/412 of 1ocmA
- active site: K62 (= K69), S131 (= S152), S132 (= S153), T152 (= T173), G153 (= G174), G154 (= G175), S155 (= S176)
- binding pyrophosphate 2-: R113 (≠ S121), S131 (= S152), Q151 (≠ D172), T152 (= T173), G153 (= G174), G154 (= G175), S155 (= S176), R158 (≠ I179), P359 (≠ G377)
Q9MUK5 Translocon at the outer membrane of chloroplasts 64 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see paper)
40% identity, 33% coverage: 62:210/451 of query aligns to 62:204/593 of Q9MUK5
Sites not aligning to the query:
- 516 N→A: Loss of HSP90 binding, but no effect on HSP70 binding.
- 550 R→A: 80% decrease of HSP70 and HSP90 binding.
6te4A Structural insights into pseudomonas aeruginosa type six secretion system exported effector 8: tse8 in complex with a peptide (see paper)
31% identity, 49% coverage: 9:230/451 of query aligns to 11:238/564 of 6te4A
Sites not aligning to the query:
Q9TUI8 Fatty-acid amide hydrolase 1; Anandamide amidase; Anandamide amidohydrolase 1; Fatty acid ester hydrolase; Oleamide hydrolase 1; EC 3.5.1.99; EC 3.1.1.- from Sus scrofa (Pig) (see paper)
31% identity, 44% coverage: 2:200/451 of query aligns to 79:265/579 of Q9TUI8
- S217 (= S152) mutation to A: Loss of activity.
- S218 (= S153) mutation to A: Lowers activity by at least 98%.
- D237 (= D172) mutation D->E,N: Loss of activity.
- S241 (= S176) mutation to A: Loss of activity.
- C249 (≠ N184) mutation to A: Loss of activity.
Query Sequence
>Ac3H11_417 FitnessBrowser__acidovorax_3H11:Ac3H11_417
MLPDLITTRDQLREGATTAPAELERCIDAAQAPANTYSFVRTMFDEARTTAVQPGLAQLP
LAGLAVSVKDLFDIAGQATPAGSTALADAPAAAQDCPAVARLRAAGASLIGRTNMVEFAF
SGVGVNPHHGTPAAWDARSGALPGAPRVPGGSSSGAGVSVATGAAFIGLGSDTGGSIRIP
AALNGIVGFKNTAHLVPTTGAVPLSTTLDTACAMTRSVRDAIVAHEVLAARRVTRSLAPL
SQYRLAVPSTLFLDGLDATVAQAFERTLRTLRQAGAHIDTIPLPAVAEQPAYGFAAPEAY
AWHRELLQRAGNRYDPRVRMRIEKGATLMAWEYIDLLQARQQWIARMLADMEPYDTLLSP
TVPIVAPLVADVAPADGTDKARDAARDAEFFRVNNLLLRNTSVVNLLDGCALSLPCHAPG
ELPVGLMVWHGALRDDTVLNVGLQIEQTLQK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory