SitesBLAST
Comparing Ac3H11_4180 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
45% identity, 88% coverage: 7:328/367 of query aligns to 16:337/378 of P69874
- C26 (≠ T17) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y18) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F37) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S46) mutation to T: Loss of ATPase activity and transport.
- L60 (= L52) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L68) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V127) mutation to M: Loss of ATPase activity and transport.
- D172 (= D164) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ L266) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (= E288) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
1g291 Malk (see paper)
45% identity, 82% coverage: 9:308/367 of query aligns to 4:314/372 of 1g291
- binding magnesium ion: D69 (≠ R75), E71 (vs. gap), K72 (vs. gap), K79 (≠ H79), D80 (≠ K80), E292 (= E288), D293 (≠ R289)
- binding pyrophosphate 2-: S38 (= S44), G39 (= G45), C40 (≠ S46), G41 (= G47), K42 (= K48), T43 (= T49), T44 (= T50)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
41% identity, 97% coverage: 9:365/367 of query aligns to 7:366/375 of 2d62A
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
51% identity, 62% coverage: 14:241/367 of query aligns to 9:236/393 of P9WQI3
- H193 (= H198) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hprC Lpqy-sugabc in state 4 (see paper)
48% identity, 62% coverage: 14:241/367 of query aligns to 8:235/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y18), S38 (= S44), G39 (= G45), G41 (= G47), K42 (= K48), S43 (≠ T49), Q82 (= Q88), Q133 (≠ R139), G136 (= G142), G137 (= G143), Q138 (= Q144), H192 (= H198)
- binding magnesium ion: S43 (≠ T49), Q82 (= Q88)
8hprD Lpqy-sugabc in state 4 (see paper)
48% identity, 62% coverage: 14:241/367 of query aligns to 8:235/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y18), S38 (= S44), C40 (≠ S46), G41 (= G47), K42 (= K48), S43 (≠ T49), T44 (= T50), Q82 (= Q88), R129 (= R135), Q133 (≠ R139), S135 (= S141), G136 (= G142), G137 (= G143), Q159 (≠ E165), H192 (= H198)
- binding magnesium ion: S43 (≠ T49), Q82 (= Q88)
8hplC Lpqy-sugabc in state 1 (see paper)
39% identity, 91% coverage: 14:346/367 of query aligns to 8:344/384 of 8hplC
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
46% identity, 63% coverage: 9:241/367 of query aligns to 3:234/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
46% identity, 63% coverage: 9:241/367 of query aligns to 3:234/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y18), S37 (= S44), G38 (= G45), C39 (≠ S46), G40 (= G47), K41 (= K48), S42 (≠ T49), T43 (= T50), Q81 (= Q88), R128 (= R135), A132 (≠ R139), S134 (= S141), G136 (= G143), Q137 (= Q144), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (≠ T49), Q81 (= Q88)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
46% identity, 63% coverage: 9:241/367 of query aligns to 3:234/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y18), G38 (= G45), C39 (≠ S46), G40 (= G47), K41 (= K48), S42 (≠ T49), T43 (= T50), R128 (= R135), S134 (= S141), Q137 (= Q144)
- binding beryllium trifluoride ion: S37 (= S44), G38 (= G45), K41 (= K48), Q81 (= Q88), S134 (= S141), G136 (= G143), H191 (= H198)
- binding magnesium ion: S42 (≠ T49), Q81 (= Q88)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
46% identity, 63% coverage: 9:241/367 of query aligns to 3:234/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y18), V17 (= V24), G38 (= G45), C39 (≠ S46), G40 (= G47), K41 (= K48), S42 (≠ T49), T43 (= T50), R128 (= R135), A132 (≠ R139), S134 (= S141), Q137 (= Q144)
- binding tetrafluoroaluminate ion: S37 (= S44), G38 (= G45), K41 (= K48), Q81 (= Q88), S134 (= S141), G135 (= G142), G136 (= G143), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (≠ T49), Q81 (= Q88)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
46% identity, 63% coverage: 9:241/367 of query aligns to 3:234/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y18), V17 (= V24), G38 (= G45), C39 (≠ S46), G40 (= G47), K41 (= K48), S42 (≠ T49), T43 (= T50), R128 (= R135), A132 (≠ R139), S134 (= S141), Q137 (= Q144)
- binding magnesium ion: S42 (≠ T49), Q81 (= Q88)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
46% identity, 63% coverage: 9:241/367 of query aligns to 4:235/371 of P68187
- A85 (= A91) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P112) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V120) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A123) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D125) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ T130) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G143) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D164) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R234) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
46% identity, 63% coverage: 9:241/367 of query aligns to 1:232/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y18), S35 (= S44), G36 (= G45), C37 (≠ S46), G38 (= G47), K39 (= K48), S40 (≠ T49), T41 (= T50), R126 (= R135), A130 (≠ R139), S132 (= S141), G134 (= G143), Q135 (= Q144)
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
43% identity, 77% coverage: 9:292/367 of query aligns to 7:280/353 of 1vciA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
44% identity, 63% coverage: 9:241/367 of query aligns to 4:235/369 of P19566
- L86 (= L92) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P166) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D171) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
3d31A Modbc from methanosarcina acetivorans (see paper)
38% identity, 81% coverage: 28:325/367 of query aligns to 19:312/348 of 3d31A
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 76% coverage: 13:292/367 of query aligns to 8:283/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 76% coverage: 13:292/367 of query aligns to 8:283/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 76% coverage: 13:292/367 of query aligns to 8:283/353 of 1oxuA
Query Sequence
>Ac3H11_4180 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
MNPPAEPLVRFTGVQKTYDGEQLVVRALDLDIQRGEFLSLLGPSGSGKTTTLMMLAGFES
PTAGDILLDGKQITRTPPHKRNFGMVFQNYALFPHLTVGENVAYPLTVRKVPKAEQAERV
KKALDMVRLTGMADRLPARLSGGQQQRVALARALVFNPQLVLMDEPLGALDKQLREHMQI
ELKELHRQLGVTFVYVTHDQGEALTMSDRVAVFNEGVIQQLADVESLYETPSNRFVAGFV
GDSTVLSGTLQGAGADAAIQMPGGFLLPGVNVNQAPVGARVQACVRPERVVLLPQSEYPR
PNAIPATVARTIYYGDHLRLICDLGHGQEQATVKRALSPSGAGASHPQPGDPVLLEFPPS
ATRIYAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory