SitesBLAST
Comparing Ac3H11_4184 FitnessBrowser__acidovorax_3H11:Ac3H11_4184 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
59% identity, 97% coverage: 11:492/498 of query aligns to 3:481/482 of P25526
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
59% identity, 97% coverage: 11:492/498 of query aligns to 2:480/481 of 3jz4A
- active site: N156 (= N163), K179 (= K186), E254 (= E264), C288 (= C298), E385 (= E397), E462 (= E474)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (= P161), W155 (= W162), K179 (= K186), A181 (= A188), S182 (≠ E189), A212 (≠ S219), G216 (= G226), G232 (= G242), S233 (= S243), I236 (≠ V246), C288 (= C298), K338 (= K348), E385 (= E397), F387 (= F399)
P51649 Succinate-semialdehyde dehydrogenase, mitochondrial; Aldehyde dehydrogenase family 5 member A1; NAD(+)-dependent succinic semialdehyde dehydrogenase; EC 1.2.1.24 from Homo sapiens (Human) (see 5 papers)
57% identity, 96% coverage: 16:494/498 of query aligns to 58:535/535 of P51649
- C93 (≠ L51) to F: in SSADHD; 3% of activity; dbSNP:rs765561257
- G176 (= G134) to R: in SSADHD; <1% of activity; dbSNP:rs72552281
- H180 (≠ P138) to Y: 83% of activity; dbSNP:rs2760118
- P182 (≠ F140) to L: 48% of activity; dbSNP:rs3765310
- R213 (= R171) binding ; mutation to A: Reduces catalytic activity to less than 15% of wild-type.
- C223 (= C181) to Y: in SSADHD; 5% of activity; dbSNP:rs72552282
- KPAE 228:231 (= KPAE 186:189) binding
- T233 (= T191) to M: in SSADHD; 4% of activity; dbSNP:rs1326526453
- A237 (= A195) to S: 65% of activity; dbSNP:rs62621664
- N255 (= N213) to S: in SSADHD; 17% of activity; dbSNP:rs145087265
- G268 (= G226) to E: in SSADHD; <1% of activity; dbSNP:rs375628463
- GSTTTG 284:289 (≠ GSTEVG 242:247) binding
- R334 (= R292) binding ; mutation to A: Reduces catalytic activity to less than 15% of wild-type.
- N335 (= N293) to K: in SSADHD; 1% of activity; dbSNP:rs72552283
- C340 (= C298) modified: Disulfide link with 342, In inhibited form
- C342 (= C300) modified: Disulfide link with 340, In inhibited form; mutation to A: Loss of regulation by redox state.
- N372 (= N329) natural variant: N -> S
- P382 (= P339) to L: in SSADHD; 2% of activity
- V406 (= V363) to I: in dbSNP:rs143741652
- G409 (= G366) to D: in SSADHD; <1% of activity; dbSNP:rs118203984
- S498 (≠ A457) binding ; mutation to A: Reduces catalytic activity to less than 15% of wild-type.
- G533 (= G492) to R: in SSADHD; <1% of activity; dbSNP:rs72552284
Sites not aligning to the query:
- 36 G → R: no effect on succinate-semialdehyde dehydrogenase activity; dbSNP:rs4646832
2w8rA The crystal structure of human ssadh in complex with NAD+ (see paper)
57% identity, 96% coverage: 16:494/498 of query aligns to 8:485/485 of 2w8rA
2w8qA The crystal structure of human ssadh in complex with ssa. (see paper)
57% identity, 96% coverage: 16:494/498 of query aligns to 8:485/485 of 2w8qA
8c54A Cryo-em structure of nadh bound sla dehydrogenase rlgabd from rhizobium leguminosarum bv. Trifolii srd1565
55% identity, 97% coverage: 11:494/498 of query aligns to 2:482/482 of 8c54A
- binding 1,4-dihydronicotinamide adenine dinucleotide: I152 (= I159), T153 (= T160), P154 (= P161), K179 (= K186), A212 (≠ S219), K213 (≠ D220), F230 (= F240), T231 (= T241), G232 (= G242), S233 (= S243), V236 (= V246), W239 (≠ I249), G256 (= G266)
4pz2B Structure of zm aldh2-6 (rf2f) in complex with NAD (see paper)
40% identity, 96% coverage: 10:487/498 of query aligns to 2:482/494 of 4pz2B
- active site: N159 (= N163), K182 (= K186), E258 (= E264), C292 (= C298), E392 (= E397), D469 (≠ E474)
- binding nicotinamide-adenine-dinucleotide: I155 (= I159), I156 (≠ T160), P157 (= P161), W158 (= W162), N159 (= N163), M164 (= M168), K182 (= K186), A184 (= A188), E185 (= E189), G215 (≠ S219), G219 (= G226), F233 (= F240), T234 (= T241), G235 (= G242), S236 (= S243), V239 (= V246), E258 (= E264), L259 (= L265), C292 (= C298), E392 (= E397), F394 (= F399)
5x5uA Crystal structure of alpha-ketoglutarate-semialdehyde dehydrogenase (kgsadh) complexed with NAD (see paper)
39% identity, 96% coverage: 15:491/498 of query aligns to 1:474/476 of 5x5uA
- active site: N151 (= N163), K174 (= K186), E249 (= E264), C283 (= C298), E380 (= E397), E457 (= E474)
- binding glycerol: D15 (≠ V29), A16 (≠ G30), A17 (≠ S31), G19 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: P149 (= P161), P207 (≠ S219), A208 (≠ D220), S211 (≠ G226), G227 (= G242), S228 (= S243), V231 (= V246), R329 (≠ A344), R330 (≠ A345), E380 (= E397), F382 (= F399)
5x5tA Crystal structure of alpha-ketoglutarate semialdehyde dehydrogenase (kgsadh) from azospirillum brasilense (see paper)
39% identity, 96% coverage: 15:491/498 of query aligns to 1:474/476 of 5x5tA
4pxlA Structure of zm aldh2-3 (rf2c) in complex with NAD (see paper)
39% identity, 94% coverage: 22:487/498 of query aligns to 9:474/486 of 4pxlA
- active site: N154 (= N163), K177 (= K186), E253 (= E264), C287 (= C298), E384 (= E397), D461 (≠ E474)
- binding nicotinamide-adenine-dinucleotide: I150 (= I159), V151 (≠ T160), P152 (= P161), W153 (= W162), K177 (= K186), E180 (= E189), G210 (≠ S219), G214 (= G226), A215 (≠ K227), F228 (= F240), G230 (= G242), S231 (= S243), V234 (= V246), E253 (= E264), G255 (= G266), C287 (= C298), Q334 (≠ A345), K337 (= K348), E384 (= E397), F386 (= F399)
O14293 Putative aldehyde dehydrogenase-like protein C9E9.09c; EC 1.2.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 95% coverage: 15:487/498 of query aligns to 18:491/503 of O14293
- S248 (= S243) modified: Phosphoserine
Sites not aligning to the query:
- 501 modified: Phosphoserine
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
37% identity, 95% coverage: 16:489/498 of query aligns to 7:483/487 of Q9H2A2
- R109 (≠ Y117) mutation to A: About 65-fold loss of catalytic efficiency.
- N155 (= N163) mutation to A: Complete loss of activity.
- R451 (≠ A457) mutation to A: Complete loss of activity.
Q56YU0 Aldehyde dehydrogenase family 2 member C4; ALDH1a; Protein REDUCED EPIDERMAL FLUORESCENCE 1; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 96% coverage: 14:491/498 of query aligns to 15:493/501 of Q56YU0
- G152 (≠ L146) mutation to E: In ref1-7; reduced activity on sinapaldehyde.
- G416 (≠ A414) mutation to R: In ref1-6; reduced activity on sinapaldehyde.
7radA Crystal structure analysis of aldh1b1
37% identity, 97% coverage: 7:491/498 of query aligns to 2:486/493 of 7radA
- binding nicotinamide-adenine-dinucleotide: I158 (= I159), I159 (≠ T160), P160 (= P161), W161 (= W162), N162 (= N163), M167 (= M168), K185 (= K186), E188 (= E189), G218 (≠ S219), G222 (= G226), A223 (≠ K227), T237 (= T241), G238 (= G242), S239 (= S243), V242 (= V246), E261 (= E264), L262 (= L265), C295 (= C298), E392 (= E397), F394 (= F399)
- binding 3-(2-methoxyphenyl)-1-(4-phenylphenyl)-6,7,8,9-tetrahydro-5~{H}-imidazo[1,2-a][1,3]diazepine: L113 (vs. gap), E117 (≠ Y117), F163 (= F164), E285 (≠ A288), F289 (≠ R292), N450 (≠ I455), V452 (≠ A457)
7mjdA Crystal structure analysis of aldh1b1
37% identity, 97% coverage: 7:491/498 of query aligns to 2:486/493 of 7mjdA
- binding nicotinamide-adenine-dinucleotide: I158 (= I159), I159 (≠ T160), P160 (= P161), W161 (= W162), N162 (= N163), M167 (= M168), K185 (= K186), E188 (= E189), G218 (≠ S219), G222 (= G226), F236 (= F240), T237 (= T241), G238 (= G242), S239 (= S243), V242 (= V246), E261 (= E264), L262 (= L265), C295 (= C298), E392 (= E397), F394 (= F399)
- binding 8-(2-methoxyphenyl)-10-(4-phenylphenyl)-1$l^{4},8-diazabicyclo[5.3.0]deca-1(7),9-diene: E117 (≠ Y117), E285 (≠ A288), F289 (≠ R292), N450 (≠ I455), V452 (≠ A457)
7mjcA Crystal structure analysis of aldh1b1
37% identity, 97% coverage: 7:491/498 of query aligns to 2:486/493 of 7mjcA
- binding nicotinamide-adenine-dinucleotide: I158 (= I159), I159 (≠ T160), P160 (= P161), W161 (= W162), N162 (= N163), K185 (= K186), E188 (= E189), G218 (≠ S219), G222 (= G226), T237 (= T241), G238 (= G242), S239 (= S243), V242 (= V246), E261 (= E264), L262 (= L265), C295 (= C298), E392 (= E397), F394 (= F399)
6j76A Structure of 3,6-anhydro-l-galactose dehydrogenase in complex with nap (see paper)
37% identity, 93% coverage: 23:487/498 of query aligns to 6:471/477 of 6j76A
- active site: N148 (= N163), E246 (= E264), C280 (= C298), E458 (= E474)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I144 (= I159), T145 (= T160), A146 (≠ P161), W147 (= W162), N148 (= N163), K171 (= K186), T173 (≠ A188), S174 (≠ E189), G204 (≠ S222), G208 (= G226), T223 (= T241), G224 (= G242), S225 (= S243), A228 (≠ V246), S231 (≠ I249), I232 (≠ L250), E246 (= E264), L247 (= L265), C280 (= C298), E381 (= E397), F383 (= F399), H447 (vs. gap)
O24174 Betaine aldehyde dehydrogenase 1; OsBADH1; EC 1.2.1.8 from Oryza sativa subsp. japonica (Rice) (see paper)
37% identity, 95% coverage: 14:487/498 of query aligns to 4:485/505 of O24174
- N164 (= N163) mutation to A: Slightly reduced affinity for NAD, 6-fold enhanced affinity for both gamma-4-aminobutyraldehyde (GAB-ald) and betaine aldehyde (Bet-ald), but 2-fold decrease in catalytic efficiency.
- W172 (≠ R171) mutation to A: Slightly reduced affinity for NAD, enhanced affinity for both betaine aldehyde (Bet-ald) (10-fold) and gamma-4-aminobutyraldehyde (GAB-ald) (2-fold).; mutation to F: Slightly reduced affinity for NAD, but 6-fold enhanced affinity for both gamma-4-aminobutyraldehyde (GAB-ald) and betaine aldehyde (Bet-ald) and 2-fold increase in catalytic efficiency towards GAB-ald.
Q63639 Retinal dehydrogenase 2; RALDH 2; RalDH2; Aldehyde dehydrogenase family 1 member A2; ALDH1A2; Retinaldehyde-specific dehydrogenase type 2; RALDH(II); EC 1.2.1.36 from Rattus norvegicus (Rat) (see paper)
38% identity, 96% coverage: 8:487/498 of query aligns to 23:507/518 of Q63639
4neaA 1.90 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) from staphylococcus aureus in complex with NAD+ and bme-free cys289 (see paper)
37% identity, 94% coverage: 23:490/498 of query aligns to 22:492/505 of 4neaA
- active site: N166 (= N163), K189 (= K186), E264 (= E264), C298 (= C298), E399 (= E397), E476 (= E474)
- binding nicotinamide-adenine-dinucleotide: P164 (= P161), K189 (= K186), E192 (= E189), G222 (≠ D218), G226 (= G226), G242 (= G242), G243 (≠ S243), T246 (≠ V246), H249 (≠ I249), I250 (≠ L250), C298 (= C298), E399 (= E397), F401 (= F399)
Query Sequence
>Ac3H11_4184 FitnessBrowser__acidovorax_3H11:Ac3H11_4184
MDMKTSPLALLNDPTLLKTDGLINGQWVVGSSRFDVNDPATGLKLADVANLGPADAEAAI
AAANAAWGPWKTKTAKERSIILRKWFDLLMANQDDLGRIMTAEQGKPLAEAKGEVAYGAS
FVEWFAEEAKRINGETLPQFDNNRRLMVLKQPIGVCAAITPWNFPLAMITRKVAPALAAG
CPVVIKPAELTPLTALAAAELAIRAGIPAGVFNILPADSDNSIAIGKVLCASDVVRHISF
TGSTEVGRILMAQSAPTVKKMSLELGGNAPFIVFDDADIDSAVEGAFASKYRNAGQTCVC
TNRFYVQEGVYDEFVAKFAAKVKTAKVGNGFEAGVNQGPLIEEAALTKVQRHVDDALAKG
GQVVAGGQRLTALGSGQFFEPTVVANATADMLCAREETFGPFAPVFKFKTEQEAIDAANN
TEFGLASYFYSRDVGRIFRVTEALEYGMVGANVGILATEHVPFGGVKQSGLGREGSHHGM
DDYVEIKYLCLGDIQSGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory