SitesBLAST
Comparing Ac3H11_4331 NADP-dependent malic enzyme (EC 1.1.1.40) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
60% identity, 97% coverage: 19:778/781 of query aligns to 4:755/759 of P76558
- K56 (≠ N71) modified: N6-acetyllysine
6zngF Maeb full-length acetyl-coa bound state (see paper)
45% identity, 97% coverage: 24:777/781 of query aligns to 8:743/753 of 6zngF
- active site: Y38 (= Y54), A74 (= A90), K93 (= K109), E135 (= E151), D136 (= D152), D160 (= D176), D161 (= D177), N286 (= N302)
- binding acetyl coenzyme *a: R511 (≠ T533), K514 (= K536), Y552 (≠ T575), A553 (= A576), R557 (≠ L580), L560 (≠ D583), P571 (≠ Y603), T590 (≠ H622), V591 (= V623), N592 (= N624), L593 (≠ Y625), Y625 (≠ H657), Q659 (≠ H692), L690 (≠ I723), N694 (= N727), Q724 (≠ T758)
6zn4A Maeb malic enzyme domain apoprotein (see paper)
57% identity, 51% coverage: 24:422/781 of query aligns to 7:405/406 of 6zn4A
6zn7A Maeb malic enzyme domain apoprotein (see paper)
57% identity, 51% coverage: 24:422/781 of query aligns to 7:405/405 of 6zn7A
- active site: Y37 (= Y54), A73 (= A90), K92 (= K109), E134 (= E151), D135 (= D152), D159 (= D176), D160 (= D177), N285 (= N302)
- binding magnesium ion: E134 (= E151), D135 (= D152), D160 (= D177)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T164 (= T181), N191 (≠ S208), A193 (= A210), G194 (= G211), A195 (= A212), S196 (≠ A213), D218 (= D235), S219 (≠ L236), K235 (= K252), L260 (= L277), S261 (= S278), V262 (≠ A279), M283 (≠ L300), N285 (= N302), V315 (= V332)
5ceeA Malic enzyme from candidatus phytoplasma aywb in complex with NAD and mg2+ (see paper)
45% identity, 51% coverage: 20:421/781 of query aligns to 1:387/387 of 5ceeA
- active site: Y34 (= Y54), A70 (= A90), K89 (= K109), E131 (= E151), D132 (= D152), D156 (= D176), D157 (= D177), N283 (= N302)
- binding magnesium ion: E131 (= E151), D132 (= D152), D157 (= D177)
- binding nicotinamide-adenine-dinucleotide: T161 (= T181), N188 (≠ S208), G189 (= G209), G191 (= G211), A193 (= A213), D213 (= D235), K214 (≠ L236), V258 (≠ L277), S259 (= S278), I263 (≠ V282), L281 (= L300), N283 (= N302), V312 (= V332), N314 (= N334)
2dvmA NAD complex structure of ph1275 protein from pyrococcus horikoshii
45% identity, 51% coverage: 20:421/781 of query aligns to 1:398/438 of 2dvmA
- active site: Y37 (= Y54), R73 (≠ A90), K92 (= K109), E134 (= E151), D135 (= D152), D159 (= D176), D160 (= D177), N296 (= N302)
- binding nicotinamide-adenine-dinucleotide: T164 (= T181), G194 (= G211), A195 (= A212), A196 (= A213), V217 (≠ T234), E218 (≠ D235), L219 (= L236), P224 (≠ E245), F269 (≠ L277), T270 (≠ S278), L294 (= L300), N296 (= N302), N327 (= N334)
2a9fA Crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
50% identity, 45% coverage: 17:368/781 of query aligns to 2:350/383 of 2a9fA
2haeD Crystal structure of a putative malic enzyme (malate oxidoreductase)
45% identity, 50% coverage: 24:414/781 of query aligns to 2:373/373 of 2haeD
2haeB Crystal structure of a putative malic enzyme (malate oxidoreductase)
45% identity, 50% coverage: 24:414/781 of query aligns to 2:373/373 of 2haeB
- active site: Y31 (= Y54), A67 (= A90), K86 (= K109), E128 (= E151), D129 (= D152), D153 (= D176), D154 (= D177), N280 (= N302)
- binding nicotinamide-adenine-dinucleotide: T158 (= T181), N185 (≠ S208), G188 (= G211), A189 (= A212), A190 (= A213), D210 (= D235), R211 (≠ L236), V255 (≠ L277), S256 (= S278), R257 (≠ A279), L278 (= L300), A279 (= A301), N280 (= N302), N311 (= N334)
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 41% coverage: 456:778/781 of query aligns to 402:710/714 of Q8ZND6
Sites not aligning to the query:
- 252 R→H: Increases speed of forward and back reactions by 2-3 fold. Not inhibited by NADH.
- 273 G→D: Increases speed of forward and back reactions by 2-3 fold.
- 294 M→I: Slightly decreases speed of forward and back reactions.
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
33% identity, 42% coverage: 448:777/781 of query aligns to 8:334/339 of 6ioxA
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
29% identity, 41% coverage: 459:777/781 of query aligns to 20:324/325 of 1xcoD
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
26% identity, 41% coverage: 458:777/781 of query aligns to 17:328/333 of P38503
- C159 (= C605) mutation to A: Loss of activity.; mutation to S: No loss of activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
26% identity, 41% coverage: 458:777/781 of query aligns to 16:327/332 of 2af3C
- binding coenzyme a: R86 (≠ T533), S127 (≠ T575), L131 (= L579), V135 (≠ D583), L146 (≠ D594), A147 (≠ S595), G172 (≠ H622), M173 (≠ V623), M173 (≠ V623), V174 (≠ N624), E175 (≠ Y625), N278 (= N727), Y281 (= Y730), K282 (≠ N731), Q285 (≠ K734), G294 (= G744), P295 (= P745), T297 (≠ L747), D306 (≠ I756), L307 (= L757), S308 (≠ T758)
P40927 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Columba livia (Rock dove) (see 3 papers)
27% identity, 37% coverage: 84:372/781 of query aligns to 138:481/557 of P40927
- D141 (≠ N87) mutation to N: Increases Km for manganese 14-fold. Increases Km for malate 5-fold.
- R144 (≠ A90) binding ; binding
- K162 (= K109) binding ; mutation to A: Decreases kcat 235-fold. no effect on Km for NADP.
- D194 (= D130) mutation to N: No effect on Km for manganese. Increases Km for malate 8-fold.
- E234 (= E151) binding
- D235 (= D152) binding
- N238 (≠ A155) binding
- D258 (= D177) binding
- AGEA 291:294 (≠ AGAA 210:213) binding
- S325 (≠ L236) binding
- K340 (≠ D251) mutation to A: Increases Km for NADP 65-fold. No effect on kcat.
- N397 (= N302) binding
- N443 (= N334) binding ; binding
- D464 (= D355) mutation to N: No effect.
1gq2A Malic enzyme from pigeon liver (see paper)
27% identity, 37% coverage: 84:372/781 of query aligns to 137:480/555 of 1gq2A
- active site: R143 (≠ A90), K161 (= K109), E233 (= E151), D234 (= D152), D256 (= D176), D257 (= D177), N396 (= N302)
- binding manganese (ii) ion: K161 (= K109), E233 (= E151), D234 (= D152), D257 (= D177)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R143 (≠ A90), G146 (= G93), N237 (≠ A155), T261 (= T181), G289 (= G209), A290 (= A210), G291 (= G211), E292 (≠ A212), A293 (= A213), V322 (≠ T234), D323 (= D235), S324 (≠ L236), A368 (≠ S278), I370 (vs. gap), L394 (= L300), N396 (= N302), G440 (≠ V332), N441 (= N333), N442 (= N334)
- binding oxalate ion: R143 (≠ A90), L145 (= L92), D257 (= D177), N396 (= N302), N442 (= N334)
Sites not aligning to the query:
7x11A Crystal structure of me1 in complex with NADPH (see paper)
25% identity, 41% coverage: 50:367/781 of query aligns to 93:482/564 of 7x11A
- binding 6-[(7-methyl-2-propyl-imidazo[4,5-b]pyridin-4-yl)methyl]-2-[2-(1H-1,2,3,4-tetrazol-5-yl)phenyl]-1,3-benzothiazole: N244 (≠ A155), F248 (= F159), I265 (≠ Q178), Q266 (≠ H179), L302 (= L215), G303 (≠ A216), H306 (≠ N219), E345 (≠ D250), D470 (= D355)
- binding manganese (ii) ion: E240 (= E151), D241 (= D152), D264 (= D177)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R150 (≠ A90), N244 (≠ A155), T268 (= T181), A297 (= A210), G298 (= G211), E299 (≠ A212), A300 (= A213), D330 (= D235), S331 (≠ L236), K332 (≠ A237), K346 (= K252), V374 (≠ L277), A375 (≠ S278), A376 (= A279), I377 (vs. gap), L401 (= L300), S402 (≠ A301), N403 (= N302), G447 (≠ V332)
Q9SIU0 NAD-dependent malic enzyme 1, mitochondrial; AtNAD-ME1; NAD-malic enzyme 1; EC 1.1.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 41% coverage: 52:373/781 of query aligns to 141:549/623 of Q9SIU0
Sites not aligning to the query:
- 122 R→A: Impaired fumarate-mediated allosteric activation.
P23368 NAD-dependent malic enzyme, mitochondrial; NAD-ME; Malic enzyme 2; EC 1.1.1.38 from Homo sapiens (Human) (see 4 papers)
27% identity, 41% coverage: 50:371/781 of query aligns to 108:510/584 of P23368
- Y112 (= Y54) active site, Proton donor
- R165 (≠ A90) binding
- 165:173 (vs. 90:98, 67% identical) binding
- K183 (= K109) active site, Proton acceptor
- E255 (= E151) binding
- D256 (= D152) binding
- N259 (≠ A155) binding
- D279 (= D177) binding
- 311:328 (vs. 209:226, 50% identical) binding
- N421 (= N302) binding
- N466 (= N333) binding
Sites not aligning to the query:
- 1:18 modified: transit peptide, Mitochondrion
- 67 binding ; R→S: Abolishes activation by fumarate.
- 91 binding ; R→T: Abolishes activation by fumarate.
7xdgA Cryo-em structures of human mitochondrial NAD(p)+-dependent malic enzyme in a ternary complex with NAD+ and allosteric inhibitor mdsa
27% identity, 41% coverage: 50:371/781 of query aligns to 86:488/551 of 7xdgA
- binding nicotinamide-adenine-dinucleotide: K134 (vs. gap), I171 (≠ V119), R172 (≠ D120), R175 (vs. gap), F241 (= F159), D257 (= D177), T261 (= T181), L288 (≠ S208), A290 (= A210), A293 (= A213), F322 (≠ T234), D323 (= D235), K324 (≠ L236), V370 (≠ L277), A371 (≠ S278), A373 (= A279), L376 (≠ V282), S398 (≠ A301), I457 (≠ L346), L458 (≠ D347)
Sites not aligning to the query:
Query Sequence
>Ac3H11_4331 NADP-dependent malic enzyme (EC 1.1.1.40)
MPENTTAENNNSHSDKRAQLRRAALEYHEFPKPGKLAIAATKQMINQHDLALAYSPGVAA
PCEEIVKDPANAFRYTARGNLVAVISNGTAVLGLGDIGALASKPVMEGKAVLFKKFAGVD
VFDIEIDEKDPAKLVEVIAALEPTFGAVNLEDIKAPDCFYVERELRKRMKIPVFHDDQHG
TAITVAAAIVNALKVANKKIEDVKLVTSGAGAAALACLNLLLKVGVQRKNVFVTDLAGVV
YEGREELMDDDKRQFMQKTDARKLAEVMVGADVFLGLSAGNVLKPEMVATMAERPVIFAL
ANPNPEITPELAHSVRSDIIMATGRSDYPNQVNNVLCFPYIFRGALDCGATTITDEMEIA
AVHAIAELAQAEQSEVVAAAYVGEKLTFGPEYLIPKPFDPRLMMKIAPAVAQAAMDSGVA
QRPIADMDAYRERLQTFVYASGTTMKPIFDAARNAAKKRVAYAEGEEERVLRAAQIVVDE
KVARPTLIGRPAIIAQRIEKFGLRLKEGVDYDVVNTDFDHRYNDFWQTYHRMTERKGITQ
QVAKIEMRRRLTLIGSMMLHKGEVDGLICGTWGTTANHLLYIDQVIGKHAGGADSTAQDV
PVYACMNGLMLPGRQVFLVDTHVNYDPTPQELAEITALAAEEMMRFGIKPKAALLSHSNF
GTSNHPSAVKMRQTLELLRQQAPWLEVDGEMHGDVALDGKARAALMPSSELTGDANLLVF
PNIDAANIAYNLLKTAAGGGIAIGPVLLGAAKPVHILTPSATVRRIVNMTALTVADANVS
R
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory