SitesBLAST
Comparing Ac3H11_4342 FitnessBrowser__acidovorax_3H11:Ac3H11_4342 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
64% identity, 95% coverage: 23:454/454 of query aligns to 4:435/435 of 4uhmA
- active site: F11 (= F30), Y140 (= Y159), E213 (= E232), D246 (= D265), I249 (= I268), K275 (= K294), Q408 (= Q427)
- binding magnesium ion: A91 (≠ K110), D99 (= D118)
- binding pyridoxal-5'-phosphate: G107 (= G126), S108 (= S127), Y140 (= Y159), H141 (= H160), G142 (= G161), E213 (= E232), D246 (= D265), V248 (= V267), I249 (= I268), K275 (= K294)
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
62% identity, 95% coverage: 23:454/454 of query aligns to 17:448/448 of Q9I700
- W61 (= W67) binding
- T327 (= T333) binding
- R414 (= R420) binding
- Q421 (= Q427) binding
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
62% identity, 95% coverage: 23:454/454 of query aligns to 10:441/441 of 4b98A
- active site: F17 (= F30), Y146 (= Y159), E219 (= E232), D252 (= D265), I255 (= I268), K281 (= K294), Q414 (= Q427)
- binding pyridoxal-5'-phosphate: G233 (= G246), Q236 (≠ E249), F270 (= F283), G271 (= G284)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: L53 (= L66), W54 (= W67), F82 (= F95), S112 (= S125), G113 (= G126), S114 (= S127), Y146 (= Y159), H147 (= H160), G148 (= G161), E219 (= E232), S224 (= S237), D252 (= D265), V254 (= V267), I255 (= I268), K281 (= K294), Y319 (= Y332), T320 (= T333), R407 (= R420), Q414 (= Q427)
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
60% identity, 95% coverage: 23:452/454 of query aligns to 9:439/441 of 3a8uX
- active site: Y145 (= Y159), D252 (= D265), K281 (= K294), Q414 (= Q427)
- binding pyridoxal-5'-phosphate: S111 (= S125), G112 (= G126), S113 (= S127), Y145 (= Y159), H146 (= H160), G147 (= G161), E219 (= E232), D252 (= D265), V254 (= V267), I255 (= I268), K281 (= K294)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
53% identity, 96% coverage: 16:450/454 of query aligns to 2:435/439 of Q9A3Q9
- V227 (= V240) mutation to G: Decreases activity toward 3-aminobutanoate by 2-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 2-fold.
- R260 (= R273) mutation to L: Decreases activity toward 3-aminobutanoate by 30-fold.
- N285 (= N298) mutation to A: Decreases activity toward 3-aminobutanoate by 4-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 3-fold.
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
35% identity, 94% coverage: 26:454/454 of query aligns to 14:446/450 of 6gwiB
- active site: F18 (= F30), Y149 (= Y159), D255 (= D265), K284 (= K294)
- binding pyridoxal-5'-phosphate: S115 (= S125), G116 (= G126), S117 (= S127), Y149 (= Y159), H150 (= H160), G151 (= G161), E222 (= E232), D255 (= D265), V257 (= V267), I258 (= I268), K284 (= K294)
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
36% identity, 91% coverage: 41:453/454 of query aligns to 2:417/422 of 7qx3A
7q9xAAA Probable aminotransferase
37% identity, 96% coverage: 17:452/454 of query aligns to 1:444/455 of 7q9xAAA
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: L55 (= L66), W56 (= W67), S115 (= S125), G116 (= G126), S117 (= S127), Y149 (= Y159), G151 (= G161), E222 (= E232), D255 (= D265), V257 (= V267), I258 (= I268), K284 (= K294), F316 (≠ Y332), T317 (= T333), R412 (= R420)
- binding pyridoxal-5'-phosphate: F316 (≠ Y332), T317 (= T333)
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
37% identity, 96% coverage: 17:452/454 of query aligns to 1:444/455 of 4a6tC
- active site: F18 (= F30), Y149 (= Y159), E222 (= E232), D255 (= D265), I258 (= I268), K284 (= K294), V419 (≠ Q427)
- binding pyridoxal-5'-phosphate: G116 (= G126), S117 (= S127), Y149 (= Y159), H150 (= H160), G151 (= G161), E222 (= E232), D255 (= D265), V257 (= V267), I258 (= I268), K284 (= K294)
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
37% identity, 95% coverage: 20:452/454 of query aligns to 3:443/453 of 6s4gA
- active site: F17 (= F30), Y148 (= Y159), D254 (= D265), K283 (= K294)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S114 (= S125), G115 (= G126), S116 (= S127), Y148 (= Y159), H149 (= H160), G150 (= G161), E221 (= E232), D254 (= D265), V256 (= V267), I257 (= I268), K283 (= K294), F315 (≠ Y332), T316 (= T333)
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
38% identity, 90% coverage: 37:446/454 of query aligns to 22:439/447 of 5lhaA
- active site: Y146 (= Y159), D253 (= D265), K282 (= K294), T319 (= T333)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G113 (= G126), S114 (= S127), Y146 (= Y159), H147 (= H160), G148 (= G161), E220 (= E232), D253 (= D265), K282 (= K294), Y318 (= Y332), T319 (= T333)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
38% identity, 90% coverage: 37:446/454 of query aligns to 24:441/449 of 5lh9D
- active site: Y148 (= Y159), D255 (= D265), K284 (= K294), T321 (= T333)
- binding pyridoxal-5'-phosphate: G115 (= G126), S116 (= S127), Y148 (= Y159), H149 (= H160), G150 (= G161), E222 (= E232), D255 (= D265), V257 (= V267), K284 (= K294)
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
37% identity, 91% coverage: 41:452/454 of query aligns to 1:412/423 of 4a6rA
- active site: Y120 (= Y159), E190 (= E232), D223 (= D265), I226 (= I268), K252 (= K294), V387 (≠ Q427)
- binding polyacrylic acid: T84 (= T123), N85 (≠ G124), S86 (= S125), S88 (= S127), E89 (= E128), T93 (= T132), R96 (≠ K135), Y120 (= Y159), S123 (≠ V162), T124 (≠ N163)
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
37% identity, 91% coverage: 41:452/454 of query aligns to 2:416/427 of 4ba5A
- active site: Y121 (= Y159), E194 (= E232), D227 (= D265), I230 (= I268), K256 (= K294), V391 (≠ Q427)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: L27 (= L66), W28 (= W67), G88 (= G126), S89 (= S127), Y121 (= Y159), H122 (= H160), G123 (= G161), E194 (= E232), A199 (≠ S237), D227 (= D265), V229 (= V267), R384 (= R420)
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
35% identity, 96% coverage: 20:453/454 of query aligns to 3:438/443 of 7qx0B
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
35% identity, 94% coverage: 26:453/454 of query aligns to 16:446/448 of 6io1B
- active site: L20 (≠ F30), Y151 (= Y159), D257 (= D265), K286 (= K294)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ S125), G118 (= G126), A119 (≠ S127), N122 (≠ A130), Y151 (= Y159), H152 (= H160), D257 (= D265), V259 (= V267), I260 (= I268), K286 (= K294)
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
34% identity, 92% coverage: 37:454/454 of query aligns to 22:438/444 of 3i5tA
- active site: Y144 (= Y159), E216 (= E232), D249 (= D265), V252 (≠ I268), K279 (= K294), V411 (≠ Q427)
- binding pyridoxal-5'-phosphate: G111 (= G126), S112 (= S127), Y144 (= Y159), H145 (= H160), E216 (= E232), D249 (= D265), V251 (= V267), K279 (= K294), Y315 (= Y332), T316 (= T333)
Sites not aligning to the query:
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
35% identity, 91% coverage: 41:454/454 of query aligns to 1:380/384 of 5ti8B
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
33% identity, 94% coverage: 25:452/454 of query aligns to 12:446/454 of 7ypmA
- binding alanine: W57 (= W67), Y150 (= Y159)
- binding pyridoxal-5'-phosphate: S116 (= S125), G117 (= G126), S118 (= S127), Y150 (= Y159), G152 (= G161), E223 (= E232), D256 (= D265), V258 (= V267), I259 (= I268), K285 (= K294)
6s54A Transaminase from pseudomonas fluorescens (see paper)
32% identity, 91% coverage: 37:450/454 of query aligns to 28:448/453 of 6s54A
- active site: Y152 (= Y159), D258 (= D265), K287 (= K294)
- binding pyridoxal-5'-phosphate: G119 (= G126), S120 (= S127), Y152 (= Y159), H153 (= H160), G154 (= G161), E225 (= E232), D258 (= D265), V260 (= V267), I261 (= I268), K287 (= K294)
Sites not aligning to the query:
Query Sequence
>Ac3H11_4342 FitnessBrowser__acidovorax_3H11:Ac3H11_4342
MSFVHIEKPAAGPDSPRMDAEWLDAHWMPFTGNRNFKAKPRMIVSGQGAYYTDADGRKIF
DGLSGLWCSGLGHGRKDVAEAIGKAAATLDYSPAFQFGHPASFALANKLKELTPAGLDYV
FFTGSGSESADTSLKMARAYWRAKGQASKTRLIGREKGYHGVNYGGISVGGIVGNRKTFG
QGIEADHLPHTQPPAGTFQKGMAEDGGRALADKLLDVIALHDASNIAAVIVEPFSGSAGV
VIPPKGYLERIREICTQNNILLIFDEVITGFGRCGAWTGAEAFGVTPDILNFAKQVTNGA
QPLGGVIATKEIYDTFISQGGPEYMLEFPHGYTYSAHPVACAAGNAVLDILQKEDMPGRV
KALAPHFENAVHGLKGAKHVADIRNYGLAAGITISALPSEPAKRPYEIAMKCWEKGFYVR
YGGDTIQLAPPFISTSAEIDRMVSALGDALHETA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory