SitesBLAST
Comparing Ac3H11_4429 FitnessBrowser__acidovorax_3H11:Ac3H11_4429 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A1P6 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
64% identity, 93% coverage: 34:497/497 of query aligns to 6:469/469 of P0A1P6
P0A9C5 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Escherichia coli (strain K12) (see 3 papers)
63% identity, 93% coverage: 34:497/497 of query aligns to 6:469/469 of P0A9C5
- Y398 (= Y426) modified: O-AMP-tyrosine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1fpyA Crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin (see paper)
64% identity, 93% coverage: 34:497/497 of query aligns to 5:468/468 of 1fpyA
- binding adenosine-5'-diphosphate: G127 (= G156), E129 (= E158), E207 (= E236), T223 (= T252), F225 (= F254), H271 (= H300), S273 (= S302), R355 (= R384), E357 (= E386)
- binding manganese (ii) ion: E129 (= E158), E131 (= E160), E212 (= E241), E220 (= E249), H269 (= H298), E357 (= E386)
- binding phosphinothricin: E131 (= E160), E212 (= E241), G265 (= G294), H269 (= H298), R321 (= R350), E327 (= E356), R359 (= R388)
1f1hA Crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions (see paper)
64% identity, 93% coverage: 34:497/497 of query aligns to 5:468/468 of 1f1hA
- binding adenosine-5'-diphosphate: E129 (= E158), E207 (= E236), H210 (= H239), E220 (= E249), T223 (= T252), F225 (= F254), H271 (= H300), S273 (= S302), R355 (= R384)
- binding manganese (ii) ion: E129 (= E158), E131 (= E160), E212 (= E241), E220 (= E249), H269 (= H298), E357 (= E386)
2lgsA Feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine (see paper)
60% identity, 93% coverage: 34:497/497 of query aligns to 5:445/445 of 2lgsA
- binding glutamic acid: E125 (= E160), N258 (= N293), G259 (= G294), G261 (= G296), H263 (= H298), R315 (= R350), R349 (= R388)
- binding manganese (ii) ion: E123 (= E158), E125 (= E160), E206 (= E241), E214 (= E249), H263 (= H298), E347 (= E386)
1lgrA Interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium (see paper)
60% identity, 93% coverage: 34:497/497 of query aligns to 5:445/445 of 1lgrA
- binding adenosine monophosphate: E201 (= E236), T217 (= T252), F219 (= F254), H265 (= H300), S267 (= S302), R345 (= R384)
- binding manganese (ii) ion: E123 (= E158), E125 (= E160), E206 (= E241), E214 (= E249), H263 (= H298), E347 (= E386)
P77961 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Synechocystis sp. (strain PCC 6803 / Kazusa)
54% identity, 94% coverage: 27:495/497 of query aligns to 1:471/473 of P77961
- E134 (= E160) binding
- E215 (= E241) binding
- E223 (= E249) binding
- E361 (= E386) binding
3ng0A Crystal structure of glutamine synthetase from synechocystis sp. Pcc 6803
53% identity, 94% coverage: 29:497/497 of query aligns to 1:465/465 of 3ng0A
- active site: D51 (= D79), E130 (= E158), E132 (= E160), E213 (= E241), E221 (= E249), H270 (= H298), R340 (= R368), E359 (= E386), R361 (= R388)
- binding phosphoaminophosphonic acid-adenylate ester: Y126 (= Y154), E130 (= E158), K209 (≠ V237), I224 (≠ T252), F226 (= F254), H272 (= H300), S274 (= S302), R340 (= R368), R345 (= R373), R357 (= R384)
- binding manganese (ii) ion: E130 (= E158), E132 (= E160), E213 (= E241), E221 (= E249), H270 (= H298), E359 (= E386), R361 (= R388)
A0R079 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
50% identity, 95% coverage: 26:497/497 of query aligns to 1:478/478 of A0R079
- K14 (= K39) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WN39 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 5 papers)
50% identity, 95% coverage: 26:497/497 of query aligns to 1:478/478 of P9WN39
- M1 (≠ L26) modified: Initiator methionine, Removed
- E133 (= E158) binding
- E135 (= E160) binding
- E219 (= E241) binding
- E227 (= E249) binding
- H276 (= H298) binding
- E366 (= E386) binding
- Y406 (= Y426) modified: O-AMP-tyrosine; mutation to F: Unable to be adenylylated.
1htoA Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis (see paper)
50% identity, 94% coverage: 29:497/497 of query aligns to 3:477/477 of 1htoA
- active site: D53 (= D79), E132 (= E158), E134 (= E160), E218 (= E241), E226 (= E249), H275 (= H298), R346 (= R368), E365 (= E386), R367 (= R388)
- binding adenosine monophosphate: Y128 (= Y154), G130 (= G156), E132 (= E158), F231 (= F254), H277 (= H300), S279 (= S302), R363 (= R384)
- binding manganese (ii) ion: E132 (= E158), H275 (= H298), E365 (= E386)
2whiA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor and l-methionine-s- sulfoximine phosphate. (see paper)
50% identity, 94% coverage: 29:497/497 of query aligns to 2:476/476 of 2whiA
- active site: D52 (= D79), E131 (= E158), E133 (= E160), E217 (= E241), E225 (= E249), H274 (= H298), R345 (= R368), E364 (= E386), R366 (= R388)
- binding 1-(3,4-dichlorobenzyl)-3,7-dimethyl-8-morpholin-4-yl-3,7-dihydro-1H-purine-2,6-dione: Y127 (= Y154), G129 (= G156), F230 (= F254), H276 (= H300), S278 (= S302), W280 (= W304), K359 (= K381), R362 (= R384)
- binding magnesium ion: E131 (= E158), E131 (= E158), E133 (= E160), E217 (= E241), E225 (= E249), E225 (= E249), H274 (= H298), E364 (= E386)
- binding l-methionine-s-sulfoximine phosphate: E131 (= E158), E133 (= E160), E217 (= E241), E225 (= E249), G270 (= G294), H274 (= H298), R327 (= R350), E333 (= E356), R345 (= R368), R366 (= R388)
- binding phosphate ion: E131 (= E158), R350 (= R373), E364 (= E386)
4acfA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3- (butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l- methionine-s-sulfoximine phosphate.
50% identity, 94% coverage: 29:497/497 of query aligns to 1:475/475 of 4acfA
- active site: D51 (= D79), E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), H273 (= H298), R344 (= R368), E363 (= E386), R365 (= R388)
- binding {4-[6-bromo-3-(butylamino)imidazo[1,2-a]pyridin-2-yl]phenoxy}acetic acid: Y126 (= Y154), F229 (= F254), H275 (= H300), Q276 (= Q301), W279 (= W304), N356 (= N379), K358 (= K381), R361 (= R384)
- binding magnesium ion: E130 (= E158), E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), E224 (= E249), H273 (= H298), E363 (= E386)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), G269 (= G294), H273 (= H298), R326 (= R350), E332 (= E356), R344 (= R368), R365 (= R388)
3zxvA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate (see paper)
50% identity, 94% coverage: 29:497/497 of query aligns to 1:475/475 of 3zxvA
- active site: D51 (= D79), E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), H273 (= H298), R344 (= R368), E363 (= E386), R365 (= R388)
- binding magnesium ion: E130 (= E158), E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), E224 (= E249), H273 (= H298), E363 (= E386)
- binding 4-(2-tert-butyl-4-(6-methoxynaphthalen-2-yl)-3h-imidazol-4-yl)pyridin-2-amine: Y126 (= Y154), G128 (= G156), F229 (= F254), H275 (= H300), S277 (= S302), K358 (= K381), R361 (= R384)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), G269 (= G294), H273 (= H298), R326 (= R350), E332 (= E356), R344 (= R368), R365 (= R388)
3zxrA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate. (see paper)
50% identity, 94% coverage: 29:497/497 of query aligns to 1:475/475 of 3zxrA
- active site: D51 (= D79), E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), H273 (= H298), R344 (= R368), E363 (= E386), R365 (= R388)
- binding 3-(2-tert-butyl-5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline: G128 (= G156), F229 (= F254), H275 (= H300), S277 (= S302), R361 (= R384)
- binding magnesium ion: E130 (= E158), E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), E224 (= E249), H273 (= H298), E363 (= E386)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), H273 (= H298), R326 (= R350), E332 (= E356), R344 (= R368), R365 (= R388)
2bvcA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic (see paper)
50% identity, 94% coverage: 29:497/497 of query aligns to 1:475/475 of 2bvcA
- active site: D51 (= D79), E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), H273 (= H298), R344 (= R368), E363 (= E386), R365 (= R388)
- binding adenosine-5'-diphosphate: E130 (= E158), E211 (= E236), K212 (≠ V237), N226 (≠ G251), F229 (= F254), H275 (= H300), S277 (= S302), R344 (= R368), R349 (= R373), R361 (= R384), E363 (= E386)
- binding magnesium ion: E130 (= E158), E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), E224 (= E249), H273 (= H298), E363 (= E386)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E158), E132 (= E160), E216 (= E241), E224 (= E249), G269 (= G294), H273 (= H298), R326 (= R350), E332 (= E356), R344 (= R368), R365 (= R388)
5zlpJ Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
48% identity, 94% coverage: 31:497/497 of query aligns to 9:478/478 of 5zlpJ
- binding adenosine-5'-diphosphate: Y132 (= Y154), E136 (= E158), F215 (≠ E236), F232 (= F254), H278 (= H300), S280 (= S302), R351 (= R373), R362 (= R384)
- binding magnesium ion: E138 (= E160), E220 (= E241), E227 (= E249)
- binding phosphinothricin: E138 (= E160), E220 (= E241), G272 (= G294), H276 (= H298), E334 (= E356), R346 (= R368), R366 (= R388)
5zlpL Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
48% identity, 94% coverage: 31:497/497 of query aligns to 7:476/476 of 5zlpL
- binding adenosine-5'-diphosphate: G132 (= G156), E134 (= E158), F213 (≠ E236), F230 (= F254), H276 (= H300), S278 (= S302), R349 (= R373), R360 (= R384)
- binding magnesium ion: E136 (= E160), E218 (= E241), E225 (= E249)
- binding (2s)-2-amino-4-[methyl(phosphonooxy)phosphoryl]butanoic acid: E136 (= E160), E218 (= E241), G270 (= G294), H274 (= H298), E332 (= E356), R344 (= R368), R364 (= R388)
5zlpA Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
48% identity, 94% coverage: 31:497/497 of query aligns to 7:476/476 of 5zlpA
4s17A The crystal structure of glutamine synthetase from bifidobacterium adolescentis atcc 15703
49% identity, 94% coverage: 29:497/497 of query aligns to 2:452/452 of 4s17A
- active site: D52 (= D79), E127 (= E158), E129 (= E160), E213 (= E241), E221 (= E249), H270 (= H298), R339 (= R368), E353 (= E386), R355 (= R388)
- binding magnesium ion: E129 (= E160), E213 (= E241), E221 (= E249)
Query Sequence
>Ac3H11_4429 FitnessBrowser__acidovorax_3H11:Ac3H11_4429
VHSAGTQTAFISAKSFFNKRFTQENLMAKTVADVMKMVKENEVKFIDFRFTDTRGKQQHT
TVPVSHFDEDKFISGHAFDGSSIAGWKGIEASDMQLIPDPSTANIDPFFEETTLILTCDV
IEPTDGKAYDRDPRSIAKRAEAYLKASGLGDTAYFGPEPEFFIFDGVRWSTEPNHTFYEI
EEYEAPWNTGAKLEGGNRGHRPTVKGGYFPVPPVDSTQDMRAEMSLILESLGIPVEVFHH
EVAGAGQNEIGTRFSTLVERADWTILQKYVIHNVANAYGKTATFMPKPYHGDNGSGMHVH
QSVWKDGKNLFAGDGYAGLSDFALYYIGGIIKHARALNAITNPGTNSYKRLVPHFEAPVK
LAYSAKNRSASIRIPYVANPKGRRVEARFPDPLMNPYLGFAALLMAGLDGVENKIHPGEA
ATKDLYHLPPEEDKLVPTVCHSLDQALEHLDKDRAFLTKGGVFTDSMIDAYIDLKMNEVT
RFRMAVHPVEYDMYYSL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory