SitesBLAST
Comparing Ac3H11_4470 FitnessBrowser__acidovorax_3H11:Ac3H11_4470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
35% identity, 93% coverage: 16:299/304 of query aligns to 15:293/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G21), L21 (= L22), G22 (= G23), I23 (≠ V24), M24 (= M25), N43 (= N44), R44 (= R45), T45 (= T46), K48 (≠ A47), V77 (= V83), S78 (≠ G84), D82 (= D88), Q85 (≠ S91), V133 (= V139), F244 (= F250), K245 (≠ A251), H248 (≠ W254), K251 (= K257)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
35% identity, 93% coverage: 16:299/304 of query aligns to 15:290/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G21), L21 (= L22), G22 (= G23), I23 (≠ V24), M24 (= M25), N43 (= N44), R44 (= R45), T45 (= T46), K48 (≠ A47), M76 (≠ C82), V77 (= V83), S78 (≠ G84), D82 (= D88), Q85 (≠ S91), V133 (= V139), F241 (= F250), K242 (≠ A251), H245 (≠ W254), K248 (= K257)
- binding sulfate ion: T134 (≠ S140), G135 (= G141), K183 (= K189)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
32% identity, 94% coverage: 19:304/304 of query aligns to 6:286/287 of 3pduA
- binding glycerol: R242 (≠ G260), E246 (≠ D264), E246 (≠ D264), R250 (= R268)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G21), G10 (= G23), I11 (≠ V24), M12 (= M25), N31 (= N44), R32 (= R45), N33 (≠ T46), M64 (≠ C82), L65 (≠ V83), A66 (≠ G84), A70 (≠ D88), T96 (= T114), V121 (= V139), G123 (= G141), T124 (≠ G142), K171 (= K189), S231 (≠ G249), F232 (= F250), P233 (≠ A251), H236 (≠ W254), K239 (= K257)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
29% identity, 96% coverage: 13:303/304 of query aligns to 2:289/294 of 5je8B
2uyyA Structure of the cytokine-like nuclear factor n-pac
30% identity, 95% coverage: 12:301/304 of query aligns to 3:288/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G23), L16 (≠ V24), M17 (= M25), N36 (= N44), R37 (= R45), T38 (= T46), V70 (= V83), S71 (≠ G84), A75 (≠ D88), T101 (= T114), F237 (= F250), Y238 (≠ A251), Y241 (≠ W254), K244 (= K257)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
29% identity, 95% coverage: 12:301/304 of query aligns to 264:549/553 of Q49A26
- 271:285 (vs. 18:32, 47% identical) binding
- T362 (= T114) binding
- M437 (≠ I194) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ F248) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K257) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
29% identity, 95% coverage: 12:301/304 of query aligns to 263:542/546 of Q922P9
- P489 (≠ F248) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
30% identity, 95% coverage: 14:301/304 of query aligns to 1:283/287 of 3pefA
- binding glycerol: D67 (≠ N85), G123 (= G141), K171 (= K189), N175 (≠ Q193), M178 (≠ I196), L203 (= L221), G207 (= G225), N213 (≠ S231), A217 (≠ D235), F232 (= F250), H236 (≠ W254), K239 (= K257), R242 (≠ G260), R269 (≠ Q287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G23), I11 (≠ V24), M12 (= M25), N31 (= N44), R32 (= R45), S33 (≠ T46), K36 (= K49), M64 (≠ C82), L65 (≠ V83), A66 (≠ G84), A70 (≠ D88), E73 (≠ S91), T96 (= T114), V121 (= V139), G123 (= G141), S124 (≠ G142), A231 (≠ G249), F232 (= F250), H236 (≠ W254), K239 (= K257)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
31% identity, 95% coverage: 17:304/304 of query aligns to 41:330/335 of P29266
- D68 (≠ N44) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K189) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q193) mutation to Q: Decrease in activity.
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
30% identity, 98% coverage: 8:304/304 of query aligns to 27:331/336 of P31937
- 40:68 (vs. 19:43, 41% identical) binding
- LP 103:104 (≠ VG 83:84) binding
- N108 (≠ D88) binding
- T134 (= T114) binding
- K284 (= K257) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
30% identity, 95% coverage: 17:304/304 of query aligns to 3:292/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G23), N10 (≠ V24), M11 (= M25), Y29 (= Y43), D30 (≠ N44), V31 (≠ R45), M63 (≠ C82), L64 (≠ V83), P65 (≠ G84), T95 (= T114), V120 (= V139), G122 (= G141), F238 (= F250), K245 (= K257)
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
25% identity, 96% coverage: 10:302/304 of query aligns to 310:599/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
30% identity, 95% coverage: 16:304/304 of query aligns to 2:280/288 of 1wp4A
- active site: S116 (= S140), K164 (= K189), N167 (= N192), N168 (≠ Q193)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G21), L8 (= L22), G9 (= G23), A10 (≠ V24), M11 (= M25), N29 (= N44), R30 (= R45), T31 (= T46), K34 (= K49), C61 (= C82), L62 (≠ V83), P63 (≠ G84), E67 (≠ D88), S90 (≠ T114), V115 (= V139), T225 (≠ G249), F226 (= F250), K233 (= K257)
- binding sulfate ion: S116 (= S140), G117 (= G141), G118 (= G142), K164 (= K189)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
31% identity, 88% coverage: 16:283/304 of query aligns to 3:260/289 of 2cvzC
- active site: S117 (= S140), K165 (= K189), N168 (= N192), N169 (≠ Q193)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G21), L9 (= L22), G10 (= G23), A11 (≠ V24), M12 (= M25), N30 (= N44), R31 (= R45), T32 (= T46), C62 (= C82), L63 (≠ V83), P64 (≠ G84), E68 (≠ D88), E71 (≠ S91), S91 (≠ T114), V116 (= V139), F227 (= F250), K234 (= K257)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
33% identity, 81% coverage: 15:261/304 of query aligns to 2:250/298 of Q9I5I6
- 2:31 (vs. 15:44, 47% identical) binding
- P66 (≠ G84) binding
- T96 (= T114) binding ; mutation to A: Almost abolished activity.
- S122 (= S140) mutation to A: Strongly reduced activity.
- K171 (= K189) active site
- N175 (≠ Q193) mutation to A: Strongly reduced activity.
- W214 (= W232) mutation to A: Almost abolished activity.
- Y219 (vs. gap) mutation to A: Strongly reduced activity.
- K246 (= K257) binding ; mutation to A: Almost abolished activity.
- D247 (= D258) mutation to A: Almost abolished activity.
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
33% identity, 81% coverage: 15:261/304 of query aligns to 1:248/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G23), H10 (≠ V24), M11 (= M25), F29 (≠ Y43), D30 (≠ N44), L31 (≠ R45), M63 (≠ C82), L64 (≠ V83), P65 (≠ G84), T94 (= T114), V119 (= V139), G121 (= G141), F237 (= F250), K244 (= K257)
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
33% identity, 81% coverage: 15:261/304 of query aligns to 2:249/295 of 3obbA
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
27% identity, 95% coverage: 17:304/304 of query aligns to 3:286/294 of 6smyA
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
27% identity, 95% coverage: 17:304/304 of query aligns to 3:286/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G23), Q10 (≠ V24), M11 (= M25), F29 (≠ Y43), D30 (≠ N44), V31 (≠ R45), M63 (≠ C82), L64 (≠ V83), V73 (= V92), S94 (≠ T113), T95 (= T114), R122 (≠ G141)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
27% identity, 95% coverage: 17:304/304 of query aligns to 4:287/298 of P0A9V8
- QM 11:12 (≠ VM 24:25) binding
- D31 (≠ N44) binding
- L65 (≠ V83) binding
- T96 (= T114) binding
- G122 (≠ S140) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G141) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G142) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQICI 192:196) binding
- K240 (= K257) binding
Query Sequence
>Ac3H11_4470 FitnessBrowser__acidovorax_3H11:Ac3H11_4470
MPSTNPRTYDATPSRKVAFLGLGVMGYPMAGHLALAGHEVTVYNRTATKSVAWCAEYAGA
KAPKHATTPREAAAGADIVFCCVGNDNDLRSVTLGADGAFAGMQPGAIFVDHTTASAEVA
RELYAAAKALGLQFVDAPVSGGQAGAQNGQLTVMCGGDAAAFDAAQPVATAFSRAFTLLG
ESGSGQLAKMVNQICIAGLVQGLSEAVAFGQNAGLDMKQVLDVIGKGAAQSWQMDNRGKT
MVDGKFDFGFAVDWMRKDLGLVLDEAKRNGSRVPVTALVDQFYADVQQMGGNRWDTSSLI
KRLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory