Comparing Ac3H11_4475 FitnessBrowser__acidovorax_3H11:Ac3H11_4475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
4rjyA Crystal structure of e. Coli l-threonine aldolase in complex with a non-covalently uncleaved bound l-serine substrate (see paper)
51% identity, 96% coverage: 1:342/355 of query aligns to 1:320/332 of 4rjyA
4lnlA Structure of escherichia coli threonine aldolase in complex with allo- thr (see paper)
51% identity, 96% coverage: 1:342/355 of query aligns to 1:320/332 of 4lnlA
4lnjA Structure of escherichia coli threonine aldolase in unliganded form (see paper)
51% identity, 96% coverage: 1:342/355 of query aligns to 1:320/332 of 4lnjA
4lnmA Structure of escherichia coli threonine aldolase in complex with serine (see paper)
51% identity, 96% coverage: 1:342/355 of query aligns to 1:320/331 of 4lnmA
O07051 L-allo-threonine aldolase; L-allo-TA; L-allo-threonine acetaldehyde-lyase; EC 4.1.2.49 from Aeromonas jandaei (see paper)
50% identity, 99% coverage: 3:354/355 of query aligns to 5:337/338 of O07051
3wlxA Crystal structure of low-specificity l-threonine aldolase from escherichia coli
52% identity, 95% coverage: 1:338/355 of query aligns to 1:316/331 of 3wlxA
3wgcB Aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant (see paper)
50% identity, 99% coverage: 3:352/355 of query aligns to 4:332/333 of 3wgcB
3wgbD Crystal structure of aeromonas jandaei l-allo-threonine aldolase (see paper)
51% identity, 96% coverage: 3:342/355 of query aligns to 3:314/324 of 3wgbD
1jg8D Crystal structure of threonine aldolase (low-specificity)
43% identity, 99% coverage: 1:352/355 of query aligns to 2:339/344 of 1jg8D
1lw5B X-ray structure of l-threonine aldolase (low-specificity) in complex with glycine (see paper)
43% identity, 99% coverage: 1:352/355 of query aligns to 1:338/343 of 1lw5B
1lw4B X-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine (see paper)
43% identity, 99% coverage: 1:352/355 of query aligns to 1:338/343 of 1lw4B
Q8RXU4 Low-specificity L-threonine aldolase 1; Threonine aldolase 1; EC 4.1.2.48 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
41% identity, 97% coverage: 3:348/355 of query aligns to 7:344/358 of Q8RXU4
O50584 Low specificity L-threonine aldolase; Low specificity L-TA; EC 4.1.2.48 from Pseudomonas sp. (strain NCIMB 10558) (see paper)
29% identity, 48% coverage: 4:174/355 of query aligns to 8:182/346 of O50584
Sites not aligning to the query:
5vyeB Crystal structure of l-threonine aldolase from pseudomonas putida
27% identity, 48% coverage: 4:174/355 of query aligns to 6:180/344 of 5vyeB
Sites not aligning to the query:
>Ac3H11_4475 FitnessBrowser__acidovorax_3H11:Ac3H11_4475
MPDFRSDTVTQPTPAMREAMFKAPLGDDVFADDPSVNALQDHAAELLGFEAALFAPSGTQ
TNLIALWGHCQRGDEAIVGQSWHTYRWEAGGMAVLGSIQPQPVETQPDGTLRVADIAAAI
KPDDPHFARTRLVVLENTTGGQVLPPAYIADVAQLARSRGLAMHLDGARMFNAATANAAR
NGTDVYAEARALCSHFDSASLCLSKGLGAPVGSLVLGSRDFIRQARRTRKILGGGMRQAG
VLAAAGSYALQHHVRRLADDHANLDRLAQGLAEANRSHPVLKDKITVLPWQTNILFTDLH
AEVAPAFTAWLAQHGVRVTSSLYGGATRLRWVTHLDVSEADVTAALDCVARFTGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory