SitesBLAST
Comparing Ac3H11_4483 FitnessBrowser__acidovorax_3H11:Ac3H11_4483 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 90% coverage: 23:476/504 of query aligns to 7:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ A89), G75 (= G91), S76 (≠ A92), G77 (= G93), T78 (= T94), G79 (= G95), L80 (= L96), A83 (≠ G99), C84 (≠ A100), P137 (= P153), G138 (≠ S154), E139 (≠ S155), A142 (≠ C159), T143 (= T160), G146 (= G163), N147 (= N164), S149 (≠ A166), T150 (≠ E167), A152 (≠ S169), G153 (= G170), E203 (= E219), G204 (= G220), I209 (= I225), E422 (= E435), H423 (= H436)
- binding fe (iii) ion: H377 (= H391), H384 (= H398), E422 (= E435)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 91% coverage: 17:477/504 of query aligns to 2:456/459 of P9WIT1
- K354 (≠ D370) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), W322 (≠ F346), E413 (= E435), H414 (= H436), N450 (= N472)
- binding lactic acid: R318 (= R342), H369 (= H391), H376 (= H398), H414 (= H436)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E413 (= E435)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ T46), P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), W323 (≠ F346), E414 (= E435), H415 (= H436), N451 (= N472)
- binding manganese (ii) ion: H370 (= H391), H377 (= H398), E414 (= E435)
- binding pyruvic acid: R319 (= R342), H370 (= H391), H377 (= H398), H415 (= H436)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L96), R317 (= R342), W321 (≠ F346), H368 (= H391), H375 (= H398), H413 (= H436)
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), W321 (≠ F346), Y322 (≠ P347), E412 (= E435), H413 (= H436), N449 (= N472)
- binding manganese (ii) ion: H368 (= H391), H375 (= H398), E412 (= E435)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R342), H369 (= H391), H376 (= H398), H414 (= H436)
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), W322 (≠ F346), E413 (= E435), H414 (= H436), N450 (= N472)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E413 (= E435)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R342), W322 (≠ F346), H369 (= H391), H376 (= H398), H414 (= H436)
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), W322 (≠ F346), E413 (= E435), N450 (= N472)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E413 (= E435)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), H369 (= H391), E413 (= E435), N450 (= N472)
- binding deaminohydroxyvaline: R319 (= R342), H414 (= H436)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ T46), P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), W322 (≠ F346), E413 (= E435), H414 (= H436), N450 (= N472)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R342), H369 (= H391), H376 (= H398), H414 (= H436)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E413 (= E435)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), Y324 (≠ P347), H370 (= H391), E414 (= E435), N451 (= N472)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R342), W323 (≠ F346), H415 (= H436)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R342), W323 (≠ F346), H370 (= H391), H415 (= H436)
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), H370 (= H391), E414 (= E435), N451 (= N472)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R342), W323 (≠ F346), H415 (= H436)
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), Y324 (≠ P347), H370 (= H391), E414 (= E435), N451 (= N472)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), H370 (= H391), E414 (= E435), N451 (= N472)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R342), W323 (≠ F346), H415 (= H436)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), H370 (= H391), E414 (= E435), N451 (= N472)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R342), H415 (= H436)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), Y324 (≠ P347), H370 (= H391), E414 (= E435), N451 (= N472)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L96), R319 (= R342), W323 (≠ F346), H415 (= H436)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R342), W322 (≠ F346), H369 (= H391), H376 (= H398), H413 (= H436)
- binding flavin-adenine dinucleotide: E32 (≠ T46), P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), W322 (≠ F346), E412 (= E435), H413 (= H436), N449 (= N472)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E412 (= E435)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
29% identity, 87% coverage: 42:477/504 of query aligns to 28:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R342), W322 (≠ F346), S336 (≠ C358), H369 (= H391), H376 (= H398), H413 (= H436)
- binding flavin-adenine dinucleotide: P68 (≠ A89), G70 (= G91), T71 (≠ A92), G72 (= G93), T73 (= T94), G74 (= G95), G78 (= G99), V79 (≠ A100), L90 (= L111), P132 (= P153), G133 (≠ S154), A134 (≠ S155), G140 (= G163), M141 (≠ N164), A143 (= A166), T144 (≠ E167), A146 (≠ S169), S147 (≠ G170), E200 (= E219), G201 (= G220), I206 (= I225), E412 (= E435), N449 (= N472)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E412 (= E435)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
29% identity, 85% coverage: 52:479/504 of query aligns to 91:519/521 of Q8N465
- S109 (≠ Y70) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V88) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A92) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ T108) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ F114) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V133) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A150) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A166) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ V192) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G194) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D331) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R342) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F346) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ D355) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ M357) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ Q376) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ Q383) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H391) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G393) to V: slight reduction in catalytic activity
- N439 (= N396) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H398) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ L400) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I401) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ F403) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E435) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H436) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G437) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
29% identity, 85% coverage: 52:479/504 of query aligns to 38:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R342), T337 (≠ F346), K348 (≠ M357), Y379 (≠ V389), H381 (= H391), H388 (= H398), H423 (= H436)
- binding flavin-adenine dinucleotide: W39 (≠ G53), P75 (≠ A89), Q76 (≠ R90), G77 (= G91), G78 (≠ A92), N79 (≠ G93), T80 (= T94), G81 (= G95), M82 (≠ L96), G85 (= G99), S86 (≠ A100), L139 (≠ P153), G140 (≠ S154), A141 (≠ S155), C145 (= C159), G149 (= G163), N150 (= N164), A152 (= A166), T153 (≠ E167), G157 (= G171), G207 (= G220), I212 (= I225), E422 (= E435), N459 (= N472)
- binding zinc ion: H381 (= H391), H388 (= H398), E422 (= E435)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
29% identity, 85% coverage: 52:479/504 of query aligns to 38:466/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ G53), P75 (≠ A89), G77 (= G91), G78 (≠ A92), N79 (≠ G93), T80 (= T94), G81 (= G95), G85 (= G99), S86 (≠ A100), L139 (≠ P153), G140 (≠ S154), A141 (≠ S155), C145 (= C159), H146 (≠ T160), G148 (= G162), G149 (= G163), N150 (= N164), A152 (= A166), T153 (≠ E167), A155 (≠ S169), E206 (= E219), G207 (= G220), I211 (≠ V224), I212 (= I225), E422 (= E435), N459 (= N472)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R342), T337 (≠ F346), K348 (≠ M357), Y379 (≠ V389), H381 (= H391), H388 (= H398), H423 (= H436)
- binding zinc ion: H381 (= H391), H388 (= H398), E422 (= E435)
Query Sequence
>Ac3H11_4483 FitnessBrowser__acidovorax_3H11:Ac3H11_4483
VAAMNTASSAPAGPTPAERAARQAEVVQALGQAVPAHALLWHSEDTTPYECDGLTAYRQR
PLVVCLPETYDEVQAVLRACHRLQVPVVARGAGTGLSGGAMPHAMGVTLSLAKFNRILNL
SPESRTAVVQSGVRNLAISEAAAPHNLYYAPDPSSQIACTIGGNVAENSGGVHCLKYGLT
VHNVLKVKGFTVEGEPVEFGSEALDSPGYDLLAAVIGSEGMLAVITEVTVRLIPKPQLAR
CIMASFDDVRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDFVHAGYDLTAEAILLCES
DGTPEEVEEEIGRMSEVLRAAGATAISVSRDEAERLRFWSGRKNAFPASGRISPDYMCMD
STIPRKRLADILLAIQEMEKKYQLRCANVFHAGDGNLHPLILFDANDADQLHRCELFGAD
ILETSVAMGGTVTGEHGVGVEKLNSMCVQFTAEENAQMFGLKHAFDPAGLLNPGKVIPTL
NRCAEYGKMLVRGGQIRHPALPRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory