Comparing Ac3H11_4507 FitnessBrowser__acidovorax_3H11:Ac3H11_4507 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
57% identity, 99% coverage: 1:332/337 of query aligns to 7:338/343 of 3lzkC
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
31% identity, 47% coverage: 109:265/337 of query aligns to 93:243/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
31% identity, 47% coverage: 109:265/337 of query aligns to 93:243/290 of 8gsrA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
26% identity, 65% coverage: 48:265/337 of query aligns to 31:226/265 of 3r6oA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
29% identity, 67% coverage: 45:271/337 of query aligns to 29:247/279 of 6v77B
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
25% identity, 60% coverage: 65:265/337 of query aligns to 48:239/269 of 4dbhA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
26% identity, 66% coverage: 48:270/337 of query aligns to 60:272/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
26% identity, 66% coverage: 48:270/337 of query aligns to 59:271/303 of 8skyB
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
28% identity, 54% coverage: 85:265/337 of query aligns to 74:242/280 of 6j5xB
Sites not aligning to the query:
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
28% identity, 54% coverage: 85:265/337 of query aligns to 74:242/280 of 6j5xA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
23% identity, 61% coverage: 75:279/337 of query aligns to 4:201/218 of 6fogA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
23% identity, 61% coverage: 75:279/337 of query aligns to 9:206/224 of Q6P587
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
24% identity, 60% coverage: 68:270/337 of query aligns to 57:245/277 of 6iymA
>Ac3H11_4507 FitnessBrowser__acidovorax_3H11:Ac3H11_4507
MKLATYKDGSRDGQLVVVSRDLGTAHYATGIASKLQQVLDDWGFLSPQLQDLYDQLNSGR
ARHAFPFDPAQCMAPLPRAYQWADGSAYINHVELVRKARNSEVPESFYTDPLMYQGGSDD
FIGPCDDVVVPSEAMGIDFEAEIAVVTGDVKMGTNADQALDGIRLVMIANDVSLRNLIPA
ELAKGFGFFQSKPATAFGPVAVTLDELGDAWDHGRVNLTVQSTWNGRKVGMCDAGPEMTF
HFGQLIAHVAKTRNLRAGSIIGSGTVSNKGITDANGRTEWPKGYSCIAEKRCIETIQDGK
PSTDFMKFGDTIRIEVKGKDGASIFGAIDQAIAAPAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory