SitesBLAST
Comparing Ac3H11_4515 FitnessBrowser__acidovorax_3H11:Ac3H11_4515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46856 Alcohol dehydrogenase YqhD; EC 1.1.1.2 from Escherichia coli (strain K12) (see paper)
64% identity, 100% coverage: 1:386/387 of query aligns to 1:386/387 of Q46856
- GGS 38:40 (≠ GAS 38:40) binding
- 93:99 (vs. 93:99, 86% identical) binding
- T138 (= T137) binding
- N147 (= N146) binding
- K160 (= K159) binding
- YTYT 179:182 (≠ KTYT 178:181) binding
- D194 (= D193) binding
- H198 (= H197) binding
- H267 (= H267) binding
- H281 (= H281) binding
1oj7B Structural genomics, unknown function crystal structure of e. Coli k-12 yqhd (see paper)
63% identity, 99% coverage: 3:386/387 of query aligns to 6:389/390 of 1oj7B
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (= P67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T137), L142 (= L138), T145 (= T141), S147 (= S143), G152 (= G148), V154 (= V150), K163 (= K159), T185 (= T181), L186 (= L182), P187 (= P183), Q190 (= Q186), H201 (= H197), H270 (= H267), H284 (= H281)
- binding zinc ion: D197 (= D193), H201 (= H197), H270 (= H267), H284 (= H281)
1oj7A Structural genomics, unknown function crystal structure of e. Coli k-12 yqhd (see paper)
63% identity, 99% coverage: 3:386/387 of query aligns to 6:389/390 of 1oj7A
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (= P67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T137), L142 (= L138), T145 (= T141), S147 (= S143), N150 (= N146), G152 (= G148), K163 (= K159), T185 (= T181), L186 (= L182), Q190 (= Q186), D197 (= D193), H201 (= H197), H270 (= H267), H284 (= H281)
7w9yA Crystal structure of bacillus subtilis yugj in complex with NADP and nickel (see paper)
38% identity, 100% coverage: 1:387/387 of query aligns to 3:389/389 of 7w9yA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G40 (= G37), G41 (= G38), S43 (= S40), P72 (= P67), N73 (= N68), G99 (= G94), G100 (= G95), S101 (= S96), T140 (= T137), L141 (= L138), T144 (= T141), K162 (= K159), T184 (= T181), V185 (≠ L182), P186 (= P183), H189 (≠ Q186), H283 (= H281)
7w9zA Crystal structure of bacillus subtilis yugj in complex with NADP and nitrate (see paper)
39% identity, 91% coverage: 3:356/387 of query aligns to 2:357/381 of 7w9zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G37 (= G37), G38 (= G38), S40 (= S40), P69 (= P67), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T137), L138 (= L138), T141 (= T141), N146 (= N146), G148 (= G148), K159 (= K159), T181 (= T181), V182 (≠ L182), P183 (= P183), H186 (≠ Q186)
- binding nitrate ion: R72 (≠ S70), V73 (≠ F71), S74 (≠ E72), V150 (= V150), N153 (≠ H153), W154 (≠ R154), E155 (≠ A155), W263 (= W264), H270 (= H271), H280 (= H281)
8i29A Crystal structure of butanol dehydrogenase a (yqdh) in complex with nadh from fusobacterium nucleatum
31% identity, 89% coverage: 3:348/387 of query aligns to 2:346/384 of 8i29A
- binding cobalt (ii) ion: E205 (= E200), H271 (= H267), H285 (= H281)
- binding nicotinamide-adenine-dinucleotide: A102 (≠ G95), T142 (= T137), I143 (≠ L138), A146 (≠ T141), S148 (= S143), S151 (≠ N146), S153 (≠ G148), I155 (≠ V150), T186 (= T181), I187 (≠ L182), L191 (≠ Q186)
7fjgA Crystal structure of butanol dehydrogenase a (yqdh) in complex with partial nadh from fusobacterium nucleatum
31% identity, 89% coverage: 3:348/387 of query aligns to 2:346/384 of 7fjgA
1vljB Crystal structure of nadh-dependent butanol dehydrogenase a (tm0820) from thermotoga maritima at 1.78 a resolution
35% identity, 92% coverage: 1:357/387 of query aligns to 6:362/400 of 1vljB
- binding fe (iii) ion: D200 (= D193), H204 (= H197), H273 (= H267), H287 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G45 (= G38), S47 (= S40), P76 (= P67), G103 (= G94), G104 (= G95), S105 (= S96), D108 (= D99), T144 (= T137), I145 (≠ L138), T148 (= T141), T150 (≠ S143), N153 (= N146), N155 (≠ G148), K166 (= K159), T188 (= T181), L189 (= L182), Q193 (= Q186), H204 (= H197), H287 (= H281)
1vhdA Crystal structure of an iron containing alcohol dehydrogenase (see paper)
29% identity, 75% coverage: 4:293/387 of query aligns to 3:283/361 of 1vhdA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (≠ A39), S40 (= S40), E69 (≠ P67), N70 (= N68), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T137), T138 (≠ L138), T141 (= T141), S143 (= S143), T146 (≠ N146), Y148 (≠ G148), I150 (≠ V150), K158 (≠ A155), S178 (≠ T181), M179 (≠ L182), L183 (≠ Q186), D190 (= D193), H194 (= H197), H271 (= H281)
- binding zinc ion: D190 (= D193), H194 (= H197), H257 (= H267), H271 (= H281)
1o2dA Crystal structure of alcohol dehydrogenase, iron-containing (tm0920) from thermotoga maritima at 1.30 a resolution (see paper)
29% identity, 75% coverage: 4:293/387 of query aligns to 2:282/359 of 1o2dA
- binding fe (iii) ion: D189 (= D193), H193 (= H197), H256 (= H267), H270 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S38 (≠ A39), S39 (= S40), E68 (≠ P67), N69 (= N68), G95 (= G94), G96 (= G95), S97 (= S96), D100 (= D99), T136 (= T137), T137 (≠ L138), T140 (= T141), S142 (= S143), Y147 (≠ G148), I149 (≠ V150), K157 (≠ A155), S177 (≠ T181), M178 (≠ L182), L182 (≠ Q186), D189 (= D193), H193 (= H197), H270 (= H281)
Q59104 4-hydroxybutyrate dehydrogenase; 4HbD; Gamma-hydroxybutyrate dehydrogenase; GHBDH; EC 1.1.1.61 from Cupriavidus necator (Alcaligenes eutrophus) (Ralstonia eutropha) (see paper)
32% identity, 85% coverage: 60:387/387 of query aligns to 59:382/382 of Q59104
- D193 (= D193) mutation to A: Retains very low activity.
- H197 (= H197) mutation to A: Loss of activity.
- H261 (= H267) mutation to A: Loss of activity.
- H265 (= H271) mutation to A: 75% decrease in Vmax. Optimum pH is 9.5.; mutation to C: 95% decrease in Vmax. Optimum pH is 8.5.; mutation to D: Retains very low activity.; mutation to Y: Loss of activity.
- H280 (= H281) mutation to A: Retains very low activity.
3zdrA Structure of the alcohol dehydrogenase (adh) domain of a bifunctional adhe dehydrogenase from geobacillus thermoglucosidasius ncimb 11955 (see paper)
27% identity, 92% coverage: 6:360/387 of query aligns to 5:370/403 of 3zdrA
6c75B Structure of iron containing alcohol dehydrogenase from thermococcus thioreducens in a monoclinic crystal form (see paper)
28% identity, 86% coverage: 6:339/387 of query aligns to 2:326/378 of 6c75B
6c75A Structure of iron containing alcohol dehydrogenase from thermococcus thioreducens in a monoclinic crystal form (see paper)
28% identity, 86% coverage: 6:339/387 of query aligns to 2:326/378 of 6c75A
- binding fe (iii) ion: D193 (= D193), H197 (= H197), H260 (= H267), H272 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S33 (≠ G37), S35 (= S40), G91 (= G94), G92 (= G95), S93 (= S96), D96 (= D99), S139 (≠ A140), T140 (= T141), A143 (vs. gap), S148 (≠ N146), V152 (= V150), K159 (= K159), T181 (= T181), M182 (≠ L182), P183 (= P183), V186 (≠ Q186), F251 (vs. gap), H272 (= H277)
P0DJA2 Alcohol dehydrogenase 2; Alcohol dehydrogenase II; ADH II; EC 1.1.1.1 from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) (see 2 papers)
27% identity, 90% coverage: 1:347/387 of query aligns to 1:344/383 of P0DJA2
- M1 (= M1) modified: Initiator methionine, Removed
- D39 (≠ G38) binding
- N71 (= N68) binding
- G98 (= G95) binding
- S99 (= S96) binding
- T138 (= T137) binding
- T139 (≠ L138) binding
- T147 (≠ N146) binding
- F149 (≠ G148) binding
- K160 (= K159) binding
- L179 (≠ K178) binding
- G182 (≠ T181) binding
- M183 (≠ L182) binding
- D194 (= D193) binding
- H198 (= H197) binding
- H263 (= H267) binding
- H267 (= H271) binding
- H277 (= H281) binding ; binding
3ox4A Structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 complexed with NAD cofactor (see paper)
27% identity, 88% coverage: 6:347/387 of query aligns to 5:343/382 of 3ox4A
- binding fe (ii) ion: D193 (= D193), H197 (= H197), H262 (= H267), H276 (= H281)
- binding nicotinamide-adenine-dinucleotide: D38 (≠ G38), F40 (≠ S40), M41 (≠ A41), N70 (= N68), G96 (= G94), G97 (= G95), S98 (= S96), T137 (= T137), T138 (≠ L138), F148 (≠ G148), I150 (≠ V150), G181 (≠ T181), M182 (≠ L182), L186 (≠ Q186), H276 (= H281)
3owoA Structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without NAD cofactor (see paper)
27% identity, 88% coverage: 6:347/387 of query aligns to 5:343/382 of 3owoA
6jkpA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense in complex with NAD+ (see paper)
26% identity, 91% coverage: 4:357/387 of query aligns to 4:345/376 of 6jkpA
- binding nicotinamide-adenine-dinucleotide: F42 (≠ A41), G96 (= G95), D100 (= D99), T137 (= T137), T138 (≠ L138), T141 (= T141), S143 (= S143), T146 (≠ N146), S181 (≠ T181), V182 (≠ L182), P183 (= P183)
6jkoA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense (see paper)
26% identity, 91% coverage: 4:357/387 of query aligns to 4:345/376 of 6jkoA
3bfjA Crystal structure analysis of 1,3-propanediol oxidoreductase (see paper)
29% identity, 70% coverage: 60:329/387 of query aligns to 62:328/382 of 3bfjA
Query Sequence
>Ac3H11_4515 FitnessBrowser__acidovorax_3H11:Ac3H11_4515
MLNFDFHNPTHIAFGQGRIADLAKLVPAAAKVLILVGGASAEKTGTLAEVRAALGERPHA
TFSGIEPNPSFETSMKAVAQIREGGFDFLLAVGGGSVIDAVKFIAAAVRFEGDDPWAILE
KHGRNIQDAMPFGAVLTLPATGSEMNNGGVITHRAKGAKLAFGSHHTYPVFSVLDPTKTY
TLPPQQLANGVVDAFVHTVEQYLTYPVNAPVQDRFAEGILQTLIEIGPRLLTAQEPVYDD
RANLMWAATMALNGLIGAGVPQDWATHMIGHELTALHGIDHARTLAIVLPALLNERRVAK
RAKLLQYGERVWGITTGTDDERITAAIERTRDFFESMGIATRLSGYGLGGDTVNAVVAQL
EAHGMVTLGEQREITPAVSRRILEAAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory