Comparing Ac3H11_4519 FitnessBrowser__acidovorax_3H11:Ac3H11_4519 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
32% identity, 92% coverage: 10:350/372 of query aligns to 28:358/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 95% coverage: 13:365/372 of query aligns to 29:377/383 of 7uoiA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
26% identity, 85% coverage: 17:331/372 of query aligns to 28:326/377 of 7t1qA
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
26% identity, 92% coverage: 16:358/372 of query aligns to 27:363/377 of P44514
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
28% identity, 85% coverage: 41:357/372 of query aligns to 57:353/366 of Q8P8J5
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
26% identity, 92% coverage: 16:358/372 of query aligns to 31:367/380 of 5vo3A
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
28% identity, 85% coverage: 41:357/372 of query aligns to 58:348/360 of 2f7vA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
25% identity, 94% coverage: 17:367/372 of query aligns to 28:373/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
25% identity, 94% coverage: 17:367/372 of query aligns to 28:373/375 of 4pqaA
7lgpB Dape enzyme from shigella flexneri
25% identity, 85% coverage: 41:357/372 of query aligns to 52:366/377 of 7lgpB
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
35% identity, 37% coverage: 16:154/372 of query aligns to 29:168/258 of 4h2kA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
26% identity, 81% coverage: 56:355/372 of query aligns to 74:356/373 of 3rzaA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
34% identity, 37% coverage: 20:156/372 of query aligns to 31:168/265 of 4op4B
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 58% coverage: 52:267/372 of query aligns to 73:295/407 of P37111
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
30% identity, 40% coverage: 48:195/372 of query aligns to 93:239/426 of 3pfoA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
23% identity, 61% coverage: 52:277/372 of query aligns to 73:312/408 of Q03154
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
33% identity, 26% coverage: 27:124/372 of query aligns to 57:159/458 of 2pokA
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
23% identity, 94% coverage: 17:364/372 of query aligns to 26:332/341 of 5xoyA
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
32% identity, 26% coverage: 42:139/372 of query aligns to 114:215/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
32% identity, 26% coverage: 42:139/372 of query aligns to 83:184/471 of 3dljA
Sites not aligning to the query:
>Ac3H11_4519 FitnessBrowser__acidovorax_3H11:Ac3H11_4519
VRMNTVSHHSNLELIHFIRDHLAKLGVKSRLTFNEDKTKANLFATLGEGKPAGIILSGHT
DTVPWDGQDWTMDPLSALVKDGNLYGRGSADMKAFIGIAVSHAEQFLHSDAPFAIHLAFS
YEEEIGCFGVKELIADLRDANIKPLACIVGEPTSMVPAIAHKGVYRYKCCVRGKEAHSSL
TPHSVNAIEMAARVVGRVRDMAEGFEKNEPRFEGFDVPFSTSSVGQFHGGIADNVVPRDA
EFRYEFRDLPTANAAQMQAEVVAYAKSLEPAMKKVAPAAGFAFETICEIPSFLGSKDDPV
TRLAQELSGEKSTTLVAFGTEAGLFKNAGISTVVCGPGSIQQAHQPDEYVSLEQLARCEA
FMQGLARTKSFG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory