Comparing Ac3H11_4520 FitnessBrowser__acidovorax_3H11:Ac3H11_4520 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 96% coverage: 14:398/403 of query aligns to 48:425/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 93% coverage: 17:392/403 of query aligns to 13:372/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 95% coverage: 17:398/403 of query aligns to 55:429/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
30% identity, 88% coverage: 2:354/403 of query aligns to 4:357/389 of 4ewtA
Sites not aligning to the query:
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
30% identity, 85% coverage: 2:342/403 of query aligns to 7:347/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
25% identity, 79% coverage: 3:322/403 of query aligns to 7:304/391 of 3ramA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
21% identity, 71% coverage: 28:314/403 of query aligns to 13:313/383 of 7uoiA
>Ac3H11_4520 FitnessBrowser__acidovorax_3H11:Ac3H11_4520
MNVIDSIVTQAASIAAVRRDIHAHPELCFEEVRTADVVAGKLTEWGIPIHRGMGTTGVVG
IVKGRDGGASGRAIGLRADIDALPMQEFNTFAHASKHQGKMHACGHDGHVAMLLAAAQHF
AKHRNFDGTVYLIFQPAEEGGGGAREMIKDGLFEQFPMEAVYGMHNWPGMPVGQFAVSPG
PVMASSNEFKITIRGKGSHAALPHNGIDPVPIACQMVQAFQTIITRNKKPVDAGVISVTM
IHAGEATNVVPDSCELQGTVRTFTLEVLDLIEKRMQQIAEHTCAAHDAVCEFEFVRNYPP
TVNSAPEAEFARAVMASIVGESNVLAQEPTMGAEDFAFMLQAKPGAYCFIANGDGAHREM
GHGGGPCTLHNPSYDFNDDLIPLGATYWVKLAEAWLAQPAKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory