SitesBLAST
Comparing Ac3H11_4625 FitnessBrowser__acidovorax_3H11:Ac3H11_4625 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4r1lA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution
28% identity, 100% coverage: 1:413/415 of query aligns to 2:432/433 of 4r1lA
- binding adenosine-5'-diphosphate: A215 (≠ E211), E216 (≠ A212), P217 (≠ F213), S237 (≠ C231), F238 (≠ Y232), G239 (≠ A233), M240 (≠ T234), T241 (≠ A235), D305 (= D295), R329 (= R319), N340 (≠ F330)
- binding adenosine monophosphate: A215 (≠ E211), E216 (≠ A212), P217 (≠ F213), S237 (≠ C231), F238 (≠ Y232), G239 (≠ A233), M240 (≠ T234), T241 (≠ A235), D305 (= D295), R329 (= R319), N340 (≠ F330)
- binding coenzyme a: S136 (= S133), A164 (≠ T161), G165 (= G162), N166 (≠ Q163), S167 (≠ T164), I185 (≠ T182), Y188 (≠ F185), K337 (≠ R327), T408 (vs. gap)
- binding zinc ion: C252 (≠ T244), H259 (vs. gap), C314 (= C304), C316 (≠ T306)
4r1mA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution
28% identity, 98% coverage: 1:408/415 of query aligns to 2:427/435 of 4r1mA
- binding adenosine monophosphate: A215 (≠ E211), E216 (≠ A212), P217 (≠ F213), N236 (≠ Q230), S237 (≠ C231), F238 (≠ Y232), G239 (≠ A233), M240 (≠ T234), T241 (≠ A235), D305 (= D295), R329 (= R319), I335 (≠ K325), N340 (≠ F330)
- binding zinc ion: C252 (≠ T244), H259 (vs. gap), C314 (= C304), C316 (≠ T306)
2y4oA Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
30% identity, 95% coverage: 8:402/415 of query aligns to 9:418/433 of 2y4oA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (= F134), F140 (≠ V139), A213 (≠ G210), E214 (= E211), P215 (≠ A212), I235 (≠ C231), G237 (≠ A233), L238 (≠ T234), S239 (≠ A235), P244 (vs. gap), D304 (= D295), R325 (= R319), I331 (≠ K325), N336 (≠ F330)
2y4oB Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
30% identity, 95% coverage: 8:402/415 of query aligns to 9:418/432 of 2y4oB
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (= F134), F140 (≠ V139), G212 (≠ S209), A213 (≠ G210), E214 (= E211), P215 (≠ A212), I235 (≠ C231), G237 (≠ A233), L238 (≠ T234), S239 (≠ A235), P244 (vs. gap), D304 (= D295), R325 (= R319), I331 (≠ K325), N336 (≠ F330)
- binding magnesium ion: S204 (≠ P201), V228 (vs. gap)
2y27B Crystal structure of paak1 in complex with atp from burkholderia cenocepacia (see paper)
31% identity, 87% coverage: 8:367/415 of query aligns to 7:372/427 of 2y27B
- binding adenosine-5'-triphosphate: K65 (= K64), S90 (= S98), S91 (≠ P99), G92 (= G100), T93 (= T101), T94 (≠ I102), F138 (≠ V139), A211 (≠ G210), E212 (= E211), P213 (≠ A212), D232 (≠ Q230), I233 (≠ C231), Y234 (= Y232), G235 (≠ A233), L236 (≠ T234), S237 (≠ A235), D302 (= D295), I320 (≠ W316), R323 (= R319)
- binding magnesium ion: V200 (≠ A199), S202 (≠ P201), L204 (≠ V203), M226 (vs. gap), G227 (= G225), Q347 (≠ A349), L350 (vs. gap)
Sites not aligning to the query:
2y4nA Paak1 in complex with phenylacetyl adenylate (see paper)
31% identity, 87% coverage: 8:367/415 of query aligns to 7:370/426 of 2y4nA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: Y131 (≠ F134), F136 (≠ V139), G138 (≠ A141), G208 (≠ S209), A209 (≠ G210), E210 (= E211), P211 (≠ A212), I231 (≠ C231), Y232 (= Y232), G233 (≠ A233), L234 (≠ T234), S235 (≠ A235), P240 (vs. gap), D300 (= D295), R321 (= R319)
- binding magnesium ion: V198 (≠ A199), S200 (≠ P201), Q345 (≠ A349), L348 (vs. gap)
Sites not aligning to the query:
6he0A Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state (see paper)
28% identity, 98% coverage: 9:415/415 of query aligns to 30:468/477 of 6he0A
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] 2-methyl-2-oxidanyl-propanoate: S241 (= S209), G242 (= G210), E243 (= E211), P244 (vs. gap), G267 (≠ Y232), S268 (≠ A233), M269 (≠ T234), A270 (= A235), D335 (= D295), I357 (≠ W316), N371 (≠ F330)
- binding adenosine monophosphate: G242 (= G210), E243 (= E211), P244 (vs. gap), C266 (= C231), G267 (≠ Y232), S268 (≠ A233), A270 (= A235), E271 (≠ D236), D335 (= D295), N371 (≠ F330)
- binding coenzyme a: Y166 (≠ H137), A188 (vs. gap), G189 (= G159), P191 (≠ T161), S194 (≠ T164), Y210 (≠ I180), G211 (= G181), T212 (= T182), Y215 (≠ F185), H218 (≠ I188), R368 (= R327), G369 (= G328), M401 (≠ N359), V439 (≠ L389), R440 (= R390)
6hdyA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with s3-hb-amp (see paper)
27% identity, 98% coverage: 9:415/415 of query aligns to 30:465/474 of 6hdyA
- binding (3s)-3-hydroxybutanoic acid: Y162 (≠ H137), S237 (= S209), G263 (≠ Y232), S264 (≠ A233), M265 (≠ T234), A266 (= A235), F271 (vs. gap)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (3~{S})-3-oxidanylbutanoate: Y162 (≠ H137), G164 (≠ V139), S237 (= S209), G238 (= G210), E239 (= E211), P240 (vs. gap), C262 (= C231), G263 (≠ Y232), S264 (≠ A233), A266 (= A235), F271 (vs. gap), D331 (= D295), I353 (≠ W316), R356 (= R319), K453 (vs. gap)
6hdxA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with r3-hib-amp (see paper)
27% identity, 98% coverage: 9:415/415 of query aligns to 30:465/474 of 6hdxA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (2~{R})-2-methyl-3-oxidanyl-propanoate: Y162 (≠ H137), G164 (≠ V139), S237 (= S209), G238 (= G210), E239 (= E211), P240 (vs. gap), C262 (= C231), G263 (≠ Y232), S264 (≠ A233), A266 (= A235), F271 (vs. gap), D331 (= D295), I353 (≠ W316), R356 (= R319), K453 (vs. gap)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: Y162 (≠ H137), G164 (≠ V139), S237 (= S209), G263 (≠ Y232), S264 (≠ A233), A266 (= A235), F271 (vs. gap)
Query Sequence
>Ac3H11_4625 FitnessBrowser__acidovorax_3H11:Ac3H11_4625
MSTFYDALETRNPSEREAALLAALPAQVAHAQKASPAFASILAGVDASSVTSRAALARLP
VTRKYELLERQQAGRATNVFGGFSALGFGPGMTRVFASPGTIYEPEGTRPDYWRMARAIH
AAGFRGGELIHNSFSYHFVPAGSMMETGAHALGCTVFPGGTGQTEQQVQAMAELKPAGYI
GTPSFLKIIVEKAAELGVALPSVTKAMVSGEAFPPSLRDWFAERGIAGYQCYATADLGLI
AYETSAREGLVLDEGVIVEIVRPGTGDPVPEGEVGELVVTTLNPDYPLIRFGTGDLSAVL
PGPCPTGRTNTRIKGWMGRADQTTKVRGMFVHPGQIATIARRFPQVLRARLVVSGEMAND
QMVLQVETTETAEGLAHQLGDAIREVTKLRGDVQMVAPGTLPNDGKVIEDARSYR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory