Comparing Ac3H11_4626 FitnessBrowser__acidovorax_3H11:Ac3H11_4626 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
48% identity, 87% coverage: 14:256/278 of query aligns to 4:239/240 of 1ji0A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 80% coverage: 33:255/278 of query aligns to 20:253/253 of 1g9xB
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 80% coverage: 33:255/278 of query aligns to 20:253/254 of 1g6hA
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
34% identity, 81% coverage: 32:255/278 of query aligns to 17:235/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 79% coverage: 32:252/278 of query aligns to 16:235/240 of 4ymuJ
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 84% coverage: 32:264/278 of query aligns to 32:254/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 76% coverage: 32:243/278 of query aligns to 17:223/241 of 4u00A
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 81% coverage: 32:255/278 of query aligns to 17:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 81% coverage: 32:255/278 of query aligns to 17:235/238 of 6s8gA
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 81% coverage: 32:255/278 of query aligns to 17:235/235 of 6mhzA
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 77% coverage: 32:245/278 of query aligns to 18:227/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 77% coverage: 32:245/278 of query aligns to 18:227/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 77% coverage: 32:245/278 of query aligns to 18:227/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 77% coverage: 32:245/278 of query aligns to 18:227/242 of 2oljA
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 81% coverage: 32:255/278 of query aligns to 18:236/241 of 6mbnA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
30% identity, 80% coverage: 32:254/278 of query aligns to 17:234/234 of 6b89A
Sites not aligning to the query:
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
30% identity, 80% coverage: 32:254/278 of query aligns to 17:234/234 of 4p31A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 77% coverage: 30:243/278 of query aligns to 18:228/343 of P30750
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 80% coverage: 32:253/278 of query aligns to 17:233/233 of 6b8bA
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
28% identity, 77% coverage: 30:243/278 of query aligns to 19:229/344 of 3tuzC
Sites not aligning to the query:
>Ac3H11_4626 FitnessBrowser__acidovorax_3H11:Ac3H11_4626
LDWHSEGNTMDSKNIVLNVNGIEVIYNHVILVLKGVSLQVPQGSIVAILGGNGAGKTTTL
RAISNLLQGERGAVTKGSIELRGERIENLSPADLVQRGVVQVMEGRHCFAHLTIEENLMT
GSYTRTSKAEIAANLEKVYNYFPRLKTRRTSQAAYTSGGEQQMCAIGRALMANPSMVLLD
EPSMGLAPQIVEEVFNIVKDLNTKEKVTFLLAEQNTNMALKYSDYGYIMESGRVVMDGAA
SDLANNEDVKEFYLGVGGGERKSFKDVKSYKRRKRWLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory