SitesBLAST
Comparing Ac3H11_4705 FitnessBrowser__acidovorax_3H11:Ac3H11_4705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
52% identity, 94% coverage: 1:345/367 of query aligns to 77:420/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
52% identity, 92% coverage: 8:345/367 of query aligns to 4:340/365 of 3zokA
- active site: R122 (= R124), K144 (= K146), E186 (= E188), K228 (= K230), E238 (= E240), R242 (= R244), N246 (= N248), H249 (= H251), H253 (= H255), H266 (= H268)
- binding glycine: K144 (= K146), K228 (= K230), R242 (= R244)
- binding nicotinamide-adenine-dinucleotide: T44 (= T48), V45 (≠ I49), D73 (= D75), E75 (= E77), K78 (= K80), G106 (= G108), G107 (= G109), V108 (= V110), D111 (= D113), T131 (= T133), T132 (= T134), M134 (≠ L136), D138 (= D140), S139 (= S141), K144 (= K146), K153 (= K155), T174 (≠ S176), L175 (= L177), E179 (= E181), H266 (= H268)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
52% identity, 98% coverage: 6:365/367 of query aligns to 2:358/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
52% identity, 98% coverage: 6:365/367 of query aligns to 3:357/360 of 3okfA
- active site: R120 (= R124), K142 (= K146), E184 (= E188), K226 (= K230), R238 (= R244), N242 (= N248), H245 (= H251), H249 (= H255), H262 (= H268)
- binding nicotinamide-adenine-dinucleotide: N42 (= N46), L48 (= L52), D71 (= D75), E73 (= E77), K76 (= K80), G104 (= G108), G105 (= G109), V106 (= V110), D109 (= D113), T129 (= T133), T130 (= T134), L132 (= L136), D136 (= D140), T172 (≠ S176), L173 (= L177), E177 (= E181)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
54% identity, 98% coverage: 6:365/367 of query aligns to 3:361/363 of 6llaB
- active site: R121 (= R124), K143 (= K146), E185 (= E188), K227 (= K230), E237 (= E240), R242 (= R244), N246 (= N248), H249 (= H251), H253 (= H255), H266 (= H268)
- binding magnesium ion: E185 (= E188), H249 (= H251), H266 (= H268)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ I49), D72 (= D75), E74 (= E77), K77 (= K80), G105 (= G108), G106 (= G109), V107 (= V110), D110 (= D113), T130 (= T133), T131 (= T134), L133 (= L136), D137 (= D140), K143 (= K146), T173 (≠ S176), L174 (= L177), E178 (= E181)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
51% identity, 97% coverage: 6:362/367 of query aligns to 3:349/355 of 5eksA
- active site: R120 (= R124), K142 (= K146), E184 (= E188), K226 (= K230), R237 (= R244), N241 (= N248), H244 (= H251), H248 (= H255), H261 (= H268)
- binding magnesium ion: E184 (= E188), H244 (= H251), H261 (= H268)
- binding nicotinamide-adenine-dinucleotide: N42 (= N46), V45 (≠ I49), D71 (= D75), E73 (= E77), K76 (= K80), G104 (= G108), G105 (= G109), V106 (= V110), D109 (= D113), T129 (= T133), T130 (= T134), D136 (= D140), S137 (= S141), K142 (= K146), T172 (≠ S176), L173 (= L177), E177 (= E181)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
53% identity, 98% coverage: 6:365/367 of query aligns to 3:357/357 of 6lk2A
- active site: R121 (= R124), K143 (= K146), E185 (= E188), K227 (= K230), R238 (= R244), N242 (= N248), H245 (= H251), H249 (= H255), H262 (= H268)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D140), E185 (= E188), K227 (= K230), R238 (= R244), N242 (= N248), H245 (= H251), T246 (= T252), H249 (= H255), H262 (= H268)
- binding magnesium ion: E185 (= E188), H245 (= H251), H262 (= H268)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ I49), D72 (= D75), E74 (= E77), K77 (= K80), G105 (= G108), G106 (= G109), V107 (= V110), D110 (= D113), T130 (= T133), T131 (= T134), L133 (= L136), D137 (= D140), S138 (= S141), C170 (≠ T173), T173 (≠ S176), L174 (= L177), P175 (= P178), E178 (= E181)
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
46% identity, 95% coverage: 16:363/367 of query aligns to 14:356/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
45% identity, 95% coverage: 16:363/367 of query aligns to 17:351/354 of 5hvnA
- active site: R123 (= R124), K145 (= K146), E187 (= E188), K228 (= K230), R239 (= R244), N243 (= N248), H246 (= H251), H250 (= H255), H263 (= H268)
- binding nicotinamide-adenine-dinucleotide: N45 (= N46), L51 (= L52), D73 (= D75), E75 (= E77), K78 (= K80), G107 (= G108), G108 (= G109), V109 (= V110), D112 (= D113), T132 (= T133), T133 (= T134), L135 (= L136), D139 (= D140), K145 (= K146), F172 (≠ T173), T175 (≠ S176), L176 (= L177), E180 (= E181)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
41% identity, 92% coverage: 8:346/367 of query aligns to 4:322/343 of P56081
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
44% identity, 92% coverage: 18:353/367 of query aligns to 12:372/1555 of 6hqvA
- active site: R123 (= R124), K145 (= K146), E187 (= E188), K243 (= K230), E253 (= E240), R257 (= R244), N261 (= N248), H264 (= H251), H268 (= H255), H280 (= H268)
- binding glutamic acid: D139 (= D140), K145 (= K146), E187 (= E188), K243 (= K230), R257 (= R244), H264 (= H251), H280 (= H268)
- binding nicotinamide-adenine-dinucleotide: D42 (≠ S45), N44 (vs. gap), L45 (vs. gap), E76 (= E77), K79 (= K80), G107 (= G108), G108 (= G109), V109 (= V110), D112 (= D113), T132 (= T133), T133 (= T134), L135 (= L136), D139 (= D140), S140 (= S141), K145 (= K146), K154 (= K155), T175 (≠ S176), L176 (= L177), P177 (= P178), E180 (= E181), H280 (= H268)
- binding zinc ion: E187 (= E188), H264 (= H251), H280 (= H268)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
42% identity, 84% coverage: 37:346/367 of query aligns to 32:362/381 of 1dqsA
- active site: R127 (= R124), K149 (= K146), E191 (= E188), K240 (= K230), E250 (= E240), R254 (= R244), N258 (= N248), H261 (= H251), H265 (= H255), H277 (= H268)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D140), K149 (= K146), N159 (= N156), E191 (= E188), K240 (= K230), R254 (= R244), L257 (= L247), N258 (= N248), H261 (= H251), H265 (= H255), H277 (= H268), K346 (= K330)
- binding nicotinamide-adenine-dinucleotide: D41 (≠ N46), N43 (≠ T48), I44 (= I49), E78 (= E77), K81 (= K80), G111 (= G108), G112 (= G109), V113 (= V110), D116 (= D113), T136 (= T133), T137 (= T134), L139 (= L136), D143 (= D140), S144 (= S141), K158 (= K155), T179 (≠ S176), P181 (= P178), E184 (= E181), H277 (= H268)
- binding zinc ion: E191 (= E188), H261 (= H251), H277 (= H268)
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
41% identity, 92% coverage: 17:355/367 of query aligns to 18:348/362 of P9WPX9
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
41% identity, 84% coverage: 37:346/367 of query aligns to 33:370/391 of 1nvbB
- active site: R128 (= R124), K150 (= K146), E192 (= E188), K248 (= K230), E258 (= E240), R262 (= R244), N266 (= N248), H269 (= H251), H273 (= H255), H285 (= H268)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D140), K150 (= K146), N160 (= N156), E192 (= E188), K248 (= K230), R262 (= R244), L265 (= L247), N266 (= N248), H269 (= H251), H273 (= H255), K354 (= K330)
- binding zinc ion: E192 (= E188), H269 (= H251), H285 (= H268)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
41% identity, 84% coverage: 37:346/367 of query aligns to 35:372/1583 of P07547
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
47% identity, 74% coverage: 76:347/367 of query aligns to 82:366/385 of 6c5cA
- active site: R130 (= R124), K152 (= K146), E194 (= E188), K246 (= K230), E254 (= E240), R258 (= R244), N262 (= N248), H265 (= H251), H269 (= H255), H281 (= H268)
- binding nicotinamide-adenine-dinucleotide: E83 (= E77), K86 (= K80), G114 (= G108), G115 (= G109), V116 (= V110), D119 (= D113), T139 (= T133), T140 (= T134), D146 (= D140), S147 (= S141), F179 (≠ T173), T182 (≠ S176), L183 (= L177), Q187 (≠ E181)
Sites not aligning to the query:
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
40% identity, 92% coverage: 17:355/367 of query aligns to 13:339/352 of 3qbeA
- active site: R117 (= R124), K139 (= K146), E181 (= E188), K223 (= K230), R233 (= R244), N237 (= N248), H240 (= H251), H244 (= H255), H256 (= H268)
- binding zinc ion: E181 (= E188), H240 (= H251), H256 (= H268)
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
40% identity, 81% coverage: 8:306/367 of query aligns to 1:274/308 of 3clhA
- active site: R107 (= R124), K129 (= K146), E171 (= E188), K207 (= K230), R212 (= R244), N216 (= N248), H219 (= H251), H223 (= H255), H236 (= H268)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ T48), V34 (≠ I49), H38 (≠ Y53), S58 (≠ D75), E60 (= E77), K63 (= K80), G91 (= G108), G92 (= G109), V93 (= V110), D96 (= D113), T116 (= T133), T117 (= T134), L119 (= L136), D123 (= D140), A124 (≠ S141), K129 (= K146), N139 (= N156), T159 (≠ S176), L160 (= L177), E164 (= E181)
1nvaA Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp (see paper)
43% identity, 74% coverage: 37:308/367 of query aligns to 32:320/380 of 1nvaA
- active site: R127 (= R124), K149 (= K146), E191 (= E188), K247 (= K230), R257 (= R244), N261 (= N248), H264 (= H251), H268 (= H255), H280 (= H268)
- binding adenosine-5'-diphosphate: D41 (≠ N46), N43 (≠ T48), G111 (= G108), G112 (= G109), T136 (= T133), T137 (= T134), F176 (≠ T173), T179 (≠ S176), L180 (= L177)
- binding zinc ion: E191 (= E188), H264 (= H251), H280 (= H268)
3qbdA 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with NAD
39% identity, 92% coverage: 17:355/367 of query aligns to 13:331/344 of 3qbdA
- active site: R117 (= R124), K139 (= K146), E181 (= E188), K223 (= K230), R232 (= R244), N236 (= N248), H239 (= H251), H243 (= H255), H255 (= H268)
- binding nicotinamide-adenine-dinucleotide: Q40 (≠ N46), D68 (= D75), A69 (≠ G76), E70 (= E77), K73 (= K80), G101 (= G108), G102 (= G109), A103 (≠ V110), D106 (= D113), T126 (= T133), T127 (= T134), L129 (= L136), A134 (≠ S141), T169 (≠ S176), L170 (= L177)
Query Sequence
>Ac3H11_4705 FitnessBrowser__acidovorax_3H11:Ac3H11_4705
MSSREECVSIDLEGRSYNIVVGEGSLHAATTFEGLPSAHAALIVSNTTIAPLYAATLRSA
IKSRFPVVHEVLLPDGEAYKNWETLQLIFDALLSNACDRKTVLFALGGGVVGDMTGFAAA
SYMRGVPFVQVPTTLLAQVDSSVGGKTAINHPQGKNMIGAFYQPRLVVCDLATLDSLPLR
ELSAGLAEVIKYGPIADVDFLDWLESSIEDLMARDRAALAHAVRRSCEIKAWVVSQDEKE
TGLRAILNFGHTFGHAIEAGMGYGVWLHGEGVAAGMVMAAELSRRLGLVDAAFVERLTAL
IARAGLPTKGPVLDAADNAGRYLELMRIDKKSEGGEIRFVLIDGPGKAVVRAAPDALVRE
VIDACCG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory