Comparing Ac3H11_4736 FitnessBrowser__acidovorax_3H11:Ac3H11_4736 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
34% identity, 76% coverage: 7:100/124 of query aligns to 114:200/200 of 6j2lA
Sites not aligning to the query:
>Ac3H11_4736 FitnessBrowser__acidovorax_3H11:Ac3H11_4736
MSSNDSLARLAQVIESRKPANGGDPSTSYVSRLLHKGPDSFLKKIGEEATEVVMAAKDVD
HGADKSKLVYEVADLWFHSMVALAHYGLTPADVLAELERREGTSGIEEKALRKADARASQ
EGSS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory