Comparing Ac3H11_4824 FitnessBrowser__acidovorax_3H11:Ac3H11_4824 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 78% coverage: 36:264/295 of query aligns to 17:241/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
39% identity, 78% coverage: 36:264/295 of query aligns to 18:242/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 78% coverage: 36:264/295 of query aligns to 18:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 78% coverage: 36:264/295 of query aligns to 18:242/344 of 3tuiC
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 87% coverage: 12:269/295 of query aligns to 2:249/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 87% coverage: 12:269/295 of query aligns to 2:249/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 87% coverage: 12:269/295 of query aligns to 2:249/250 of 7z16I
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
33% identity, 87% coverage: 12:268/295 of query aligns to 2:263/330 of P0AAH4
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
34% identity, 81% coverage: 30:267/295 of query aligns to 7:239/240 of 4ymuJ
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
34% identity, 91% coverage: 11:278/295 of query aligns to 2:269/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
35% identity, 87% coverage: 11:267/295 of query aligns to 1:257/310 of 4fwiB
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 86% coverage: 12:264/295 of query aligns to 1:236/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
34% identity, 79% coverage: 35:267/295 of query aligns to 14:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
34% identity, 79% coverage: 35:267/295 of query aligns to 14:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
34% identity, 79% coverage: 35:267/295 of query aligns to 14:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
34% identity, 79% coverage: 35:267/295 of query aligns to 14:241/242 of 2oljA
Sites not aligning to the query:
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
37% identity, 80% coverage: 30:264/295 of query aligns to 8:249/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 80% coverage: 30:264/295 of query aligns to 12:253/258 of P02915
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 80% coverage: 35:271/295 of query aligns to 16:248/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 80% coverage: 35:271/295 of query aligns to 16:248/353 of 1oxvA
Sites not aligning to the query:
>Ac3H11_4824 FitnessBrowser__acidovorax_3H11:Ac3H11_4824
MSDNHHHTSNSPLLQVKDLVREYTLPREHLFRPPGTVQALNGVSFSIAAGRSLGVVGESG
SGKSTLARLVMALDAPTAGTVELLGRNLHQLPAEQLRQARRDFQMVFQDPYGSLDPRQTV
ERIVTEPLQAQGQTTRAEQREQAAQVLSQVGLRTNDLGKYPHEFSGGQRQRIAIARALIT
RPRLIVADEPVSALDVSVQAQVLNLMQDLQQQFGITYMLISHDLAVVNHLCDEVVVLYQG
RIVERGSPGELFRNAQHPYTQSLVGAVPQVQPGRARARRAAAAAAAVAAATAKTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory