Comparing Ac3H11_4825 FitnessBrowser__acidovorax_3H11:Ac3H11_4825 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 88% coverage: 1:301/343 of query aligns to 1:305/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
31% identity, 94% coverage: 3:323/343 of query aligns to 4:316/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
30% identity, 94% coverage: 3:323/343 of query aligns to 3:305/310 of 4fwiB
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
38% identity, 74% coverage: 3:255/343 of query aligns to 3:246/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
38% identity, 74% coverage: 3:255/343 of query aligns to 3:246/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 74% coverage: 3:255/343 of query aligns to 3:246/250 of 7z16I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 71% coverage: 9:253/343 of query aligns to 3:236/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 81% coverage: 3:281/343 of query aligns to 1:269/343 of P30750
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 71% coverage: 12:254/343 of query aligns to 8:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 71% coverage: 12:254/343 of query aligns to 8:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 71% coverage: 12:254/343 of query aligns to 8:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 71% coverage: 12:254/343 of query aligns to 8:239/242 of 2oljA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 81% coverage: 3:281/343 of query aligns to 2:270/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 81% coverage: 3:281/343 of query aligns to 2:270/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 81% coverage: 3:281/343 of query aligns to 2:270/344 of 3tuiC
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 69% coverage: 18:254/343 of query aligns to 12:237/240 of 4ymuJ
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
29% identity, 72% coverage: 1:247/343 of query aligns to 1:236/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
29% identity, 72% coverage: 1:247/343 of query aligns to 1:236/592 of 5lj7A
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 67% coverage: 3:231/343 of query aligns to 2:220/222 of 7arlD
7mdyC Lolcde nucleotide-bound
32% identity, 67% coverage: 3:231/343 of query aligns to 2:220/226 of 7mdyC
>Ac3H11_4825 FitnessBrowser__acidovorax_3H11:Ac3H11_4825
MSLLEVSNLRIRLQTHRGPADAVRGVSFSLARGETLGLIGESGCGKSITAMSLMGLLPES
AQVTGSIRFDGQELVGRTDAQMCQMRGNRIGMVFQEPMTALNPVHTIGRQVAEPLRLHRG
MNAAAARTEAIALLDRVGIPNAAQRFDAYPHQFSGGQRQRITIAMALACGPDLLIADEPT
TALDVTIQQQILDLISDLVAERNMALILISHDLGVISQNVDRMMVMYGGSVVESGSTASV
FSAMTHPYTRGLFAARPHLGTVHAPGQRPRLSTIPGTVPELVDLPAGCPFAGRCSYTIDT
CHQESPAATLVATDADGDHVVRCLRREAIAEAHGVPQGVEVAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory