SitesBLAST
Comparing Ac3H11_4835 FitnessBrowser__acidovorax_3H11:Ac3H11_4835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
64% identity, 97% coverage: 19:750/754 of query aligns to 4:724/728 of 5oasA
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
64% identity, 97% coverage: 20:750/754 of query aligns to 1:720/724 of 5vfbA
P37330 Malate synthase G; MSG; EC 2.3.3.9 from Escherichia coli (strain K12) (see 2 papers)
63% identity, 96% coverage: 28:751/754 of query aligns to 10:722/723 of P37330
- R338 (= R358) mutation to K: Has a specific activity which is only 6.6% of the wild-type activity.
- C617 (= C646) modified: Cysteine sulfenic acid (-SOH); mutation to S: Affinity binding for acetyl-CoA is more than five times greater than that of wild-type, although its specific activity is comparable.
- D631 (= D660) mutation to N: Absence of malate synthase activity.
- C688 (≠ M717) modified: Cysteine sulfenic acid (-SOH)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1p7tA Structure of escherichia coli malate synthase g:pyruvate:acetyl- coenzyme a abortive ternary complex at 1.95 angstrom resolution (see paper)
62% identity, 96% coverage: 28:751/754 of query aligns to 7:706/706 of 1p7tA
- active site: D259 (= D290), E261 (= E292), R322 (= R358), E411 (= E456), D439 (= D484), D615 (= D660)
- binding acetyl coenzyme *a: V115 (= V136), V116 (= V137), P117 (= P138), R122 (= R143), Y123 (= Y144), N126 (= N147), A127 (= A148), S263 (= S294), R295 (= R331), R322 (= R358), M492 (= M537), P520 (= P565), P522 (= P567), C601 (= C646), M613 (= M658), D615 (= D660)
- binding magnesium ion: E411 (= E456), D439 (= D484)
- binding pyruvic acid: E411 (= E456), G436 (= G481), L438 (= L483), D439 (= D484), W518 (= W563)
1d8cA Malate synthase g complexed with magnesium and glyoxylate (see paper)
62% identity, 96% coverage: 28:751/754 of query aligns to 8:709/709 of 1d8cA
- active site: D268 (= D290), E270 (= E292), R325 (= R358), E414 (= E456), D442 (= D484), D618 (= D660)
- binding glyoxylic acid: M412 (= M454), E414 (= E456), G439 (= G481), L441 (= L483), D442 (= D484)
- binding magnesium ion: E414 (= E456), D442 (= D484)
- binding sorbitol: Q59 (= Q79), H449 (= H491), V688 (≠ M730), K689 (≠ E731), Q690 (= Q732), P691 (= P733)
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
62% identity, 97% coverage: 19:750/754 of query aligns to 2:726/729 of 6axeA
- active site: D272 (= D290), E274 (= E292), R338 (= R358), E437 (= E456), D465 (= D484), D636 (= D660)
- binding acetyl coenzyme *a: V119 (= V136), V120 (= V137), R126 (= R143), F127 (≠ Y144), N130 (= N147), A131 (= A148), R311 (= R331), R338 (= R358), M518 (= M537), W544 (= W563), P546 (= P565), P548 (= P567), C622 (= C646), K624 (= K648), M634 (= M658), D636 (= D660)
- binding magnesium ion: E437 (= E456), D465 (= D484)
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
61% identity, 97% coverage: 19:753/754 of query aligns to 1:726/741 of P9WK16
- R339 (= R358) active site, Proton acceptor
- D633 (= D660) active site, Proton donor
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
61% identity, 97% coverage: 20:753/754 of query aligns to 1:719/720 of 2gq3A
- active site: D267 (= D290), E269 (= E292), R335 (= R358), E430 (= E456), D458 (= D484), D626 (= D660)
- binding coenzyme a: V114 (= V136), V115 (= V137), R121 (= R143), F122 (≠ Y144), N125 (= N147), A126 (= A148), K301 (= K324), R308 (= R331), P539 (= P565), P541 (= P567), C612 (= C646), M624 (= M658), D626 (= D660)
- binding magnesium ion: H370 (= H397), K373 (≠ Q400), N378 (= N405), G379 (= G406), L381 (≠ I407), E430 (= E456), D458 (= D484)
5e9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-chloro-6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
61% identity, 97% coverage: 20:753/754 of query aligns to 1:714/715 of 5e9xA
- active site: D267 (= D290), E269 (= E292), R327 (= R358), E422 (= E456), D450 (= D484), D621 (= D660)
- binding 2-chloranyl-6~{H}-thieno[2,3-b]pyrrole-5-carboxylic acid: V114 (= V136), S271 (= S294), M503 (= M537), M619 (= M658), E620 (= E659), D621 (= D660)
- binding magnesium ion: E422 (= E456), D450 (= D484)
5cczA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-(4-fluorophenyl)-4-methyl-1h-pyrazol-5-amine (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:712/713 of 5cczA
- active site: D267 (= D290), E269 (= E292), R325 (= R358), E420 (= E456), D448 (= D484), D619 (= D660)
- binding 3-(4-fluorophenyl)-4-methyl-1H-pyrazol-5-amine: V114 (= V136), S271 (= S294), M501 (= M537), W527 (= W563), P529 (= P565), M617 (= M658), E618 (= E659), D619 (= D660)
- binding magnesium ion: E420 (= E456), D448 (= D484)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:711/712 of 6dnpA
- active site: D270 (= D290), E272 (= E292), R328 (= R358), E419 (= E456), D447 (= D484), D618 (= D660)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R358), E419 (= E456), G444 (= G481), L446 (= L483), D447 (= D484), M500 (= M537), W526 (= W563), M616 (= M658), D618 (= D660)
- binding magnesium ion: E419 (= E456), D447 (= D484)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:718/719 of 5cbiA
- active site: D270 (= D290), E272 (= E292), R331 (= R358), E426 (= E456), D454 (= D484), D625 (= D660)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L72), N54 (≠ A73), D57 (= D76), F125 (≠ Y144), Y138 (= Y157), D139 (= D158), Y142 (= Y161), M507 (= M537), W533 (= W563), P535 (= P565), A611 (≠ C646), M623 (= M658), M623 (= M658), E624 (= E659), D625 (= D660)
- binding magnesium ion: E426 (= E456), D454 (= D484)
5cakA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-3-(1h-indol-3-yl)propanoic acid (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:716/717 of 5cakA
- active site: D270 (= D290), E272 (= E292), R329 (= R358), E424 (= E456), D452 (= D484), D623 (= D660)
- binding (2R)-2-hydroxy-3-(1H-indol-3-yl)propanoic acid: V117 (= V136), L451 (= L483), M505 (= M537), E622 (= E659), D623 (= D660)
- binding magnesium ion: E424 (= E456), D452 (= D484)
6dl9A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-cl-phenyldiketoacid (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:715/716 of 6dl9A
- active site: D270 (= D290), E272 (= E292), R328 (= R358), E423 (= E456), D451 (= D484), D622 (= D660)
- binding 4-(2,6-dichlorophenyl)-2,4-dioxobutanoic acid: V117 (= V136), R328 (= R358), E423 (= E456), G448 (= G481), L450 (= L483), D451 (= D484), M504 (= M537), W530 (= W563), M620 (= M658), D622 (= D660)
- binding magnesium ion: E423 (= E456), D451 (= D484)
5c9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,4-dichloro-5-fluorobenzoic acid (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:715/716 of 5c9xA
- active site: D270 (= D290), E272 (= E292), R328 (= R358), E423 (= E456), D451 (= D484), D622 (= D660)
- binding 2,4-dichloro-5-fluorobenzoic acid: V117 (= V136), S274 (= S294), R328 (= R358), M504 (= M537), W530 (= W563), M620 (= M658), D622 (= D660)
- binding magnesium ion: K295 (≠ Q315), H363 (= H397), K366 (≠ Q400), N371 (= N405), G372 (= G406), L374 (≠ I407), E423 (= E456), D451 (= D484)
5c7vA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-pyrrole-2-carboxylic acid (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:715/716 of 5c7vA
6c8pA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-phenyldiketoacid (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:715/716 of 6c8pA
- active site: D270 (= D290), E272 (= E292), R329 (= R358), E423 (= E456), D451 (= D484), D622 (= D660)
- binding (2Z)-4-(2-fluorophenyl)-2-hydroxy-4-oxobut-2-enoic acid: R329 (= R358), E423 (= E456), G448 (= G481), L450 (= L483), D451 (= D484), M504 (= M537), W530 (= W563), M620 (= M658), D622 (= D660)
- binding magnesium ion: E423 (= E456), D451 (= D484)
5cbbA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(3h-indol-3-ylidene)-2,5-dihydro-1h-pyrazole-3- carboxylate (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:712/713 of 5cbbA
- active site: D266 (= D290), E268 (= E292), R325 (= R358), E420 (= E456), D448 (= D484), D619 (= D660)
- binding (5E)-5-(3H-indol-3-ylidene)-2,5-dihydro-1H-pyrazole-3-carboxylic acid: V113 (= V136), S270 (= S294), F446 (= F482), L447 (= L483), M501 (= M537), W527 (= W563), M617 (= M658), E618 (= E659), D619 (= D660)
- binding magnesium ion: E420 (= E456), D448 (= D484)
5cc3A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6-bromo-1h-indole-2-carboxylic acid
60% identity, 97% coverage: 20:753/754 of query aligns to 1:714/715 of 5cc3A
- active site: D270 (= D290), E272 (= E292), R328 (= R358), E422 (= E456), D450 (= D484), D621 (= D660)
- binding 6-bromanyl-1H-indole-2-carboxylic acid: V117 (= V136), M503 (= M537), M619 (= M658), D621 (= D660)
- binding magnesium ion: E422 (= E456), D450 (= D484), V466 (= V500), R467 (= R501), T470 (≠ D504)
5cjnA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-(3-oxo-3,4-dihydroquinoxalin-2-yl)acrylate (see paper)
60% identity, 97% coverage: 20:753/754 of query aligns to 1:711/712 of 5cjnA
- active site: D265 (= D290), E267 (= E292), R324 (= R358), E419 (= E456), D447 (= D484), D618 (= D660)
- binding 3-(3-oxo-3,4-dihydroquinoxalin-2-yl)propanoic acid: V112 (= V136), S269 (= S294), L446 (= L483), M500 (= M537), M616 (= M658), E617 (= E659), D618 (= D660)
- binding magnesium ion: N289 (≠ A323), K290 (= K324), H359 (= H397), K362 (≠ Q400), N367 (= N405), E419 (= E456), D447 (= D484)
Query Sequence
>Ac3H11_4835 FitnessBrowser__acidovorax_3H11:Ac3H11_4835
VHHRSVAAFFPLFSASFSMTDRTPIHGLQVATSLFRFIEDKVLPGTGVGGEAFWKGFDAI
VADLAPRNIALLAERDRLQTELDTWHKANPGPIQNMVAYRSFLEKIGYLVPQPADVKATT
ANVDDELATQAGPQLVVPILNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKGYNP
VRGAKVIAFARQVLDDTAPLASGSHKDSTGYKVEGGQLVVSLANGSTTGLKDASQFKGYQ
GNAAAPSSVLLQHNGLHLDIQIDRSTPIGQSDAAGVSDLVLEAALSTILDLEDSVAAVDA
EDKVLGYSNWLGIIQATLTEQVAKGGKTITRGLNGDRIYTGPTGGEVRLHGRSLMFLRNV
GHLMTNPAILWTDAQGTQREIPEGIMDAVVTTAIALHDLQGHGANGIRNSRKGSVYIVKP
KMHGPAEVGFAAELFGRVEKLLGLPDSTVKLGIMDEERRTSVNLKACIAAASSRVAFINT
GFLDRTGDEMHTAMHAGPMVRKGDMKTSAWIQSYEKNNVLVGLSCGLRGKAQIGKGMWAM
PDLMAEMLKQKIAHPKAGANTAWVPSPTGATLHALHYHQVKVSDIQIELEKTDVNAERDN
LLTGLLTVPVAAAPNWSDAEKQQELDNNAQGILGYVVRWVDQGVGCSKVPDIHNVGLMED
RATLRISSQHLANWLHHGVVTEAQVRATFERMAAVVDGQNAGDPLYQPMAGNFGTSMAYK
AACDLVFKGMEQPSGYTEPLLHAWRLKLKAAQAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory