SitesBLAST
Comparing Ac3H11_4848 FitnessBrowser__acidovorax_3H11:Ac3H11_4848 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 94% coverage: 5:422/445 of query aligns to 6:347/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ L6), G8 (= G7), G10 (= G9), V11 (≠ I10), I12 (= I11), V30 (≠ I29), E31 (≠ D30), K32 (≠ R31), E38 (= E38), A39 (≠ T39), S40 (= S40), A43 (≠ N43), G45 (≠ A45), L46 (≠ Q46), V171 (= V224), G200 (≠ C263), G201 (= G264), W203 (≠ Y266), G298 (= G374), R300 (= R376), P301 (= P377), Y326 (≠ G401), R327 (≠ T402), N328 (≠ L403), G329 (= G404), I330 (≠ W405)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
25% identity, 69% coverage: 115:422/445 of query aligns to 69:349/369 of S5FMM4
- K81 (vs. gap) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ C263) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W405) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L415) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
23% identity, 57% coverage: 168:422/445 of query aligns to 121:349/369 of O31616
- V174 (= V224) binding
- H244 (≠ K308) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R376) binding
- 327:333 (vs. 400:406, 29% identical) binding
- R329 (≠ T402) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
23% identity, 57% coverage: 168:422/445 of query aligns to 121:349/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ D223), V174 (= V224), S202 (≠ C263), G203 (= G264), W205 (≠ Y266), F209 (≠ L270), G300 (= G374), R302 (= R376), H327 (= H400), F328 (≠ G401), R329 (≠ T402), N330 (≠ L403), G331 (= G404), I332 (≠ W405)
- binding glycolic acid: Y246 (≠ I310), R302 (= R376), R329 (≠ T402)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
23% identity, 57% coverage: 168:422/445 of query aligns to 121:349/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ I310), R302 (= R376), R329 (≠ T402)
- binding flavin-adenine dinucleotide: V174 (= V224), S202 (≠ C263), G203 (= G264), W205 (≠ Y266), F209 (≠ L270), G300 (= G374), R302 (= R376), H327 (= H400), R329 (≠ T402), N330 (≠ L403), G331 (= G404), I332 (≠ W405)
- binding phosphate ion: R254 (≠ H318)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
24% identity, 70% coverage: 117:428/445 of query aligns to 75:362/377 of Q5L2C2
- V180 (= V224) binding
- R309 (= R376) binding
- 334:340 (vs. 400:406, 29% identical) binding
- R336 (≠ T402) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 70% coverage: 117:428/445 of query aligns to 74:360/368 of 4yshB
- active site: I262 (≠ V321), L283 (= L346), G305 (= G374), N335 (≠ L403), L338 (≠ T406)
- binding flavin-adenine dinucleotide: V178 (= V224), S206 (≠ C263), W209 (≠ Y266), R307 (= R376), H332 (= H400), R334 (≠ T402), N335 (≠ L403), G336 (= G404), I337 (≠ W405), L338 (≠ T406)
- binding glycine: G249 (≠ K308), Y251 (≠ I310), Y251 (≠ I310), A264 (≠ G323), R307 (= R376), R334 (≠ T402), R334 (≠ T402)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 70% coverage: 117:428/445 of query aligns to 74:360/370 of 4yshA
- active site: I262 (≠ V321), L283 (= L346), G305 (= G374), N335 (≠ L403), L338 (≠ T406)
- binding flavin-adenine dinucleotide: V178 (= V224), S206 (≠ C263), G207 (= G264), W209 (≠ Y266), R307 (= R376), H332 (= H400), R334 (≠ T402), N335 (≠ L403), G336 (= G404), I337 (≠ W405)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
6j39A Crystal structure of cmis2 with inhibitor (see paper)
22% identity, 95% coverage: 11:431/445 of query aligns to 11:364/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (≠ Q46), P46 (= P54), N49 (= N57), R243 (≠ M300), Y252 (≠ K309), Y267 (≠ I325), R308 (= R376), R334 (≠ T402), I335 (≠ L403)
- binding flavin-adenine dinucleotide: I11 (= I11), V29 (≠ I29), D30 (= D30), P31 (= P33), E32 (≠ D34), K36 (≠ E38), A37 (≠ T39), S38 (= S40), V40 (≠ A42), S41 (≠ N43), A42 (= A44), G43 (≠ A45), M44 (≠ Q46), A174 (≠ D223), A203 (≠ C263), W206 (≠ Y266), I228 (vs. gap), Y252 (≠ K309), R308 (= R376), S333 (≠ G401), R334 (≠ T402), I335 (≠ L403), G336 (= G404), V337 (≠ W405), Q338 (≠ T406)
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
22% identity, 95% coverage: 11:431/445 of query aligns to 11:364/368 of 6j38A
- binding flavin-adenine dinucleotide: I11 (= I11), V29 (≠ I29), D30 (= D30), P31 (= P33), K36 (≠ E38), A37 (≠ T39), S38 (= S40), S41 (≠ N43), A42 (= A44), G43 (≠ A45), M44 (≠ Q46), A174 (≠ D223), A203 (≠ C263), W206 (≠ Y266), G226 (= G285), G306 (= G374), R308 (= R376), S333 (≠ G401), R334 (≠ T402), I335 (≠ L403), G336 (= G404), V337 (≠ W405), Q338 (≠ T406)
Sites not aligning to the query:
Query Sequence
>Ac3H11_4848 FitnessBrowser__acidovorax_3H11:Ac3H11_4848
MKTIVLGAGIIGISTAWHLLERGHEVIVIDRQPDAALETSFANAAQISVSYCEPWANREA
PLKALKWMFDKEAPLLFRPQMDWQQWRWGLQFLAQCNDTAFERNVQQIVALGAYSHAALK
DLVGTTGIEYNRLERGIAHFYTDQKSFDAAGHAVELMRKHGVQRRLVSRDELLQIEPAFR
AYGDKITGGTYTSTDESGDARVFTQELARRCIARGAQFLYGHDVLRLNKIGNAIDSVAVM
ARQPGGGGKKDFILKADAVVVACGSYSAPLLRSVGVDLPIYPGKGYSATFPLLRPEGAPM
VSTIDDGKKIAMSRLGNHLRVAGTIELNGWDLTLDSSLARARCHMLSRRIEAILPGVCDT
RTPEEGGDPQYWTGLRPATPTNIPFIGRTRVGKLWVNAGHGTLGWTHGAGSGKALAELIS
GQVPAMNFGFCGMEQGNRTLTAKVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory