Comparing Ac3H11_4899 FitnessBrowser__acidovorax_3H11:Ac3H11_4899 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
55% identity, 91% coverage: 23:262/264 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
55% identity, 91% coverage: 23:262/264 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
55% identity, 91% coverage: 23:262/264 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
55% identity, 91% coverage: 23:262/264 of query aligns to 3:241/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
55% identity, 91% coverage: 23:262/264 of query aligns to 1:239/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
55% identity, 91% coverage: 22:262/264 of query aligns to 1:239/241 of 4u00A
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
54% identity, 89% coverage: 26:260/264 of query aligns to 9:254/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
54% identity, 89% coverage: 26:260/264 of query aligns to 5:250/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 86% coverage: 37:263/264 of query aligns to 19:246/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
42% identity, 86% coverage: 37:263/264 of query aligns to 20:247/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
42% identity, 86% coverage: 37:263/264 of query aligns to 20:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
42% identity, 86% coverage: 37:263/264 of query aligns to 20:247/344 of 3tuiC
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
36% identity, 83% coverage: 23:240/264 of query aligns to 3:224/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
35% identity, 83% coverage: 23:240/264 of query aligns to 2:223/245 of 7tchB
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 92% coverage: 22:263/264 of query aligns to 16:252/378 of P69874
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
37% identity, 81% coverage: 23:237/264 of query aligns to 3:220/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
37% identity, 81% coverage: 23:237/264 of query aligns to 3:220/592 of 5lj7A
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
37% identity, 90% coverage: 24:261/264 of query aligns to 3:235/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
37% identity, 90% coverage: 24:261/264 of query aligns to 1:233/367 of 1q12A
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
37% identity, 90% coverage: 24:261/264 of query aligns to 4:236/371 of P68187
Sites not aligning to the query:
>Ac3H11_4899 FitnessBrowser__acidovorax_3H11:Ac3H11_4899
MATAADTTLAPAHDGIVVGEPPIVDITALRKSYGSNEVLKGIDLKVQRGEVIAIIGKSGS
GKSTLLRCVNGLEEFQEGALSVNGKKLLHDSPTAMRELRQQVGMIFQSFNLFPHLSVGRN
IMLAPTLVKARDAKTAETQARKLLERVGLAEKFDAMPDQLSGGQQQRVAIARALAMEPQV
LLCDEITSALDPELVGEVLRVVESLAQEGMTLMMVTHEMAFARKVGDRVIFMHQGRVHEQ
GTPAALFGNPQTPELQQFLSSLHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory