Comparing Ac3H11_4983 FitnessBrowser__acidovorax_3H11:Ac3H11_4983 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 89% coverage: 14:263/280 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 89% coverage: 14:263/280 of query aligns to 4:253/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
34% identity, 89% coverage: 14:263/280 of query aligns to 2:235/240 of 6mjpA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 89% coverage: 13:262/280 of query aligns to 1:236/241 of 4u00A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 89% coverage: 15:263/280 of query aligns to 3:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 89% coverage: 15:263/280 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 89% coverage: 15:263/280 of query aligns to 3:235/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 89% coverage: 15:263/280 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 89% coverage: 15:262/280 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 89% coverage: 15:262/280 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 88% coverage: 15:261/280 of query aligns to 3:233/233 of 6b8bA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
28% identity, 85% coverage: 14:251/280 of query aligns to 4:228/501 of P04983
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
29% identity, 91% coverage: 10:263/280 of query aligns to 2:238/240 of 1ji0A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
28% identity, 85% coverage: 14:252/280 of query aligns to 4:224/285 of 4yerA
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 86% coverage: 14:253/280 of query aligns to 2:228/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 86% coverage: 14:253/280 of query aligns to 4:230/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 86% coverage: 14:253/280 of query aligns to 4:230/263 of 7d08B
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 87% coverage: 12:254/280 of query aligns to 2:230/280 of 5x40A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 89% coverage: 14:263/280 of query aligns to 1:237/240 of 4ymuJ
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 92% coverage: 17:274/280 of query aligns to 6:251/353 of 1oxvD
>Ac3H11_4983 FitnessBrowser__acidovorax_3H11:Ac3H11_4983
METTPSGPAVATPLLQVQGVTLAFGGVKALTGVGFDVLPGSITAVIGPNGAGKTSLFNTI
SGFYRPSQGSIRFQGQDITRVPAPQRARLGLGRSFQNIALFRGMTVLDNIKLGRHAHLKT
NVLDALLYFGRARREEAELRRDIEERIIDFLEIDHIRHAPVSALPYGLQKRVEMARALAM
QPQILMLDEPVAGMNREETEDMARFILDVREEWGVTVLMVEHDMGMVMDLSDHVVVLNFG
QVIAQGTPAAVQANPEVIRAYLGAGDVGDLRAKLQGVTTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory