Comparing Ac3H11_4987 FitnessBrowser__acidovorax_3H11:Ac3H11_4987 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
51% identity, 89% coverage: 9:249/272 of query aligns to 6:239/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 88% coverage: 9:248/272 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 88% coverage: 9:248/272 of query aligns to 4:253/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
34% identity, 81% coverage: 29:248/272 of query aligns to 21:235/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 83% coverage: 24:248/272 of query aligns to 16:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 83% coverage: 24:248/272 of query aligns to 16:235/238 of 6s8gA
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 83% coverage: 24:248/272 of query aligns to 16:235/235 of 6mhzA
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 81% coverage: 29:248/272 of query aligns to 22:236/241 of 6mbnA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 82% coverage: 24:247/272 of query aligns to 16:234/234 of 6b89A
Sites not aligning to the query:
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 82% coverage: 24:247/272 of query aligns to 16:234/234 of 4p31A
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 82% coverage: 24:246/272 of query aligns to 16:233/233 of 6b8bA
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 82% coverage: 23:245/272 of query aligns to 14:235/240 of 4ymuJ
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
27% identity, 81% coverage: 9:227/272 of query aligns to 3:221/248 of 8g4cB
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
31% identity, 82% coverage: 29:252/272 of query aligns to 23:246/265 of 7ch6C
Sites not aligning to the query:
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
31% identity, 82% coverage: 29:252/272 of query aligns to 23:246/264 of 6xgyA
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
27% identity, 82% coverage: 9:230/272 of query aligns to 3:220/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
28% identity, 82% coverage: 9:230/272 of query aligns to 3:220/230 of 6z4wA
7tchB Bceab e169q variant atp-bound conformation (see paper)
27% identity, 81% coverage: 9:227/272 of query aligns to 2:220/245 of 7tchB
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
31% identity, 82% coverage: 29:252/272 of query aligns to 23:246/263 of 7cgnB
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
27% identity, 84% coverage: 12:240/272 of query aligns to 6:232/353 of 1oxvD
>Ac3H11_4987 FitnessBrowser__acidovorax_3H11:Ac3H11_4987
MTQPTPAHVLEVNNIEVIYNKVVQALRGLSLAVPRGQIVALLGSNGAGKSTTLKAISGLL
ALEDGVVESGSIHFNGQPTAAVAPQQLVRNGLSHVMEGRRVFEDLTVEENLVAATYALTG
RSGTTPDFDLVYSYFPRLHERRKGLAGYLSGGEQQMLAIGRALIAQPQLILLDEPSLGLS
PKLVEDIFTIIARINAERGTSMLLVEQNATVALAVAHRGYIMENGKIVIDGTAERLANDP
DVREFYLGMGGGGEAKSFKDIKHYKRRKRWLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory