SitesBLAST
Comparing Ac3H11_517 FitnessBrowser__acidovorax_3H11:Ac3H11_517 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
43% identity, 100% coverage: 2:552/552 of query aligns to 2:524/526 of 5khaA
- active site: D291 (= D301), E397 (= E407)
- binding adenosine-5'-diphosphate: Y273 (= Y283), F279 (= F289), N368 (= N378), R372 (= R382), M379 (= M389), S382 (= S392), N383 (= N393), C403 (= C413), T404 (= T414), Y494 (= Y522), K495 (= K523)
2e18A Crystal structure of project ph0182 from pyrococcus horikoshii ot3
37% identity, 47% coverage: 273:530/552 of query aligns to 6:247/256 of 2e18A
Sites not aligning to the query:
P9WJJ3 Glutamine-dependent NAD(+) synthetase; NAD(+) synthase [glutamine-hydrolyzing]; EC 6.3.5.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
23% identity, 98% coverage: 6:545/552 of query aligns to 17:660/679 of P9WJJ3
- E52 (= E43) mutation to A: Lack of glutamine-dependent activity. Retains 30% of ammonia-dependent activity.
- K121 (= K119) mutation to A: Lack of glutamine-dependent and ammonia-dependent activities.
- C176 (= C155) mutation to A: Lack of glutamine-dependent activity. Retains 90% of ammonia-dependent activity.
- D656 (= D541) mutation to A: Causes a decrease in ammonia channel efficiency to 70% compared with wild-type enzyme.
3dlaA X-ray crystal structure of glutamine-dependent NAD+ synthetase from mycobacterium tuberculosis bound to naad+ and don (see paper)
24% identity, 98% coverage: 6:545/552 of query aligns to 18:632/651 of 3dlaA
- binding nicotinic acid adenine dinucleotide: R355 (≠ Y283), L359 (≠ N287), G462 (≠ A397), E472 (= E407), W477 (≠ Y412), S478 (≠ C413), T479 (= T414), Y480 (≠ L415), D484 (= D418), H488 (≠ G422), F606 (≠ Y522), K607 (= K523)
- binding 5-oxo-l-norleucine: Y128 (= Y125), F131 (= F128), C177 (= C155), E178 (= E156), F181 (≠ W159)
1xngB Crystal structure of nh3-dependent NAD+ synthetase from helicobacter pylori (see paper)
33% identity, 45% coverage: 273:523/552 of query aligns to 3:245/262 of 1xngB
- active site: D35 (= D301), E135 (= E407)
- binding adenosine-5'-triphosphate: G29 (= G295), L30 (= L296), S31 (= S297), G33 (= G299), L34 (≠ I300), D35 (= D301), S36 (= S302), M56 (= M323), R112 (= R384), T130 (= T402), E135 (= E407), K159 (= K431), S181 (= S464)
- binding nicotinic acid adenine dinucleotide: R21 (≠ N287), F23 (= F289), N106 (= N378), Y117 (≠ M389), S120 (= S392), L121 (≠ N393), L126 (≠ I398), Y140 (= Y412), G141 (≠ C413), T142 (= T414), D146 (= D418), A150 (≠ G422), A182 (= A465), F244 (≠ Y522), K245 (= K523)
O25096 NH(3)-dependent NAD(+) synthetase; EC 6.3.1.5 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
33% identity, 45% coverage: 273:523/552 of query aligns to 5:247/260 of O25096
- 31:38 (vs. 295:302, 88% identical) binding
- T132 (= T402) binding
- K161 (= K431) binding
6ofcB Crystal structure of m. Tuberculosis glutamine-dependent NAD+ synthetase complexed with sulfonamide derivative 1, pyrophosphate, and glutamine (see paper)
23% identity, 98% coverage: 6:545/552 of query aligns to 17:650/669 of 6ofcB
- binding pyrophosphate 2-: S368 (= S297), G370 (= G299), S373 (= S302), E543 (vs. gap)
- binding 5'-O-[(pyridine-3-carbonyl)sulfamoyl]adenosine: R354 (≠ Y283), L358 (≠ N287), G366 (= G295), V367 (≠ L296), S368 (= S297), A398 (≠ M322), L399 (≠ M323), R452 (= R384), G465 (≠ A397), I466 (= I398), T470 (= T402), W480 (≠ Y412), S481 (≠ C413), T482 (= T414), T482 (= T414), Y483 (≠ L415), D487 (= D418), H491 (≠ G422), F621 (≠ L519), F624 (≠ Y522), K625 (= K523)
3sytA Crystal structure of glutamine-dependent NAD+ synthetase from m. Tuberculosis bound to amp/ppi, NAD+, and glutamate (see paper)
24% identity, 98% coverage: 6:545/552 of query aligns to 17:641/660 of 3sytA
- binding adenosine monophosphate: G366 (= G295), V367 (≠ L296), S368 (= S297), S373 (= S302), L399 (≠ S325), R456 (= R384), T474 (= T402)
- binding glutamic acid: Y127 (= Y125), F180 (≠ W159), S203 (= S181), R209 (≠ K187)
- binding nicotinamide-adenine-dinucleotide: R354 (≠ Y283), L358 (≠ N287), N450 (= N378), N465 (= N393), G469 (≠ A397), E479 (= E407), W484 (≠ Y412), S485 (≠ C413), T486 (= T414), Y487 (≠ L415), D491 (= D418), H495 (≠ G422), F615 (≠ Y522), K616 (= K523)
- binding pyrophosphate 2-: S368 (= S297), G370 (= G299), L371 (≠ I300), D372 (= D301), S373 (= S302)
3sezA Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with atp and naad+ (see paper)
24% identity, 98% coverage: 6:545/552 of query aligns to 17:639/658 of 3sezA
- binding adenosine-5'-triphosphate: G366 (= G295), V367 (≠ L296), S368 (= S297), S373 (= S302), A398 (≠ P324), L399 (≠ S325), R456 (= R384), T474 (= T402)
- binding nicotinic acid adenine dinucleotide: R354 (≠ Y283), L358 (≠ N287), N465 (= N393), G469 (≠ A397), E479 (= E407), W484 (≠ Y412), S485 (≠ C413), T486 (= T414), Y487 (≠ L415), D491 (= D418), H495 (≠ G422), F613 (≠ Y522), K614 (= K523)
6ofcC Crystal structure of m. Tuberculosis glutamine-dependent NAD+ synthetase complexed with sulfonamide derivative 1, pyrophosphate, and glutamine (see paper)
23% identity, 98% coverage: 6:545/552 of query aligns to 17:646/665 of 6ofcC
- binding glutamine: Y58 (= Y49), K121 (= K119), P125 (= P123), F130 (= F128), A176 (≠ C155), E177 (= E156), F180 (≠ W159)
- binding 5'-O-[(pyridine-3-carbonyl)sulfamoyl]adenosine: R354 (≠ Y283), L358 (≠ N287), G366 (= G295), V367 (≠ L296), S368 (= S297), S373 (= S302), F397 (≠ V321), A398 (≠ M322), L399 (≠ M323), R458 (= R384), N467 (= N393), G471 (≠ A397), T476 (= T402), W486 (≠ Y412), S487 (≠ C413), T488 (= T414), Y489 (≠ L415), H497 (≠ G422), F620 (≠ Y522)
3sytD Crystal structure of glutamine-dependent NAD+ synthetase from m. Tuberculosis bound to amp/ppi, NAD+, and glutamate (see paper)
24% identity, 98% coverage: 6:545/552 of query aligns to 17:630/649 of 3sytD
- binding adenosine monophosphate: G366 (= G295), V367 (≠ L296), S368 (= S297), A398 (≠ P324), L399 (≠ S325), R446 (= R384)
- binding glutamic acid: Y127 (= Y125), E177 (= E156), F180 (≠ W159), S203 (= S181)
- binding nicotinamide-adenine-dinucleotide: R354 (≠ Y283), L358 (≠ N287), N455 (= N393), G459 (≠ A397), E469 (= E407), W474 (≠ Y412), T476 (= T414), Y477 (≠ L415), D481 (= D418), H485 (≠ G422), F604 (≠ Y522), K605 (= K523)
- binding pyrophosphate 2-: S368 (= S297), G370 (= G299), L371 (≠ I300), D372 (= D301), S373 (= S302)
3dlaB X-ray crystal structure of glutamine-dependent NAD+ synthetase from mycobacterium tuberculosis bound to naad+ and don (see paper)
23% identity, 98% coverage: 6:545/552 of query aligns to 17:630/649 of 3dlaB
- binding nicotinic acid adenine dinucleotide: L358 (≠ N287), G458 (≠ A397), W473 (≠ Y412), S474 (≠ C413), T475 (= T414), D480 (= D418), H484 (≠ G422), F601 (≠ L519), F604 (≠ Y522), K605 (= K523)
- binding 5-oxo-l-norleucine: C176 (= C155), F180 (≠ W159), S201 (≠ N179), S203 (= S181), R209 (≠ K187), Y230 (= Y208)
3seqA Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with ampcpp and naad+ (see paper)
23% identity, 98% coverage: 6:545/552 of query aligns to 18:642/661 of 3seqA
- binding diphosphomethylphosphonic acid adenosyl ester: G367 (= G295), V368 (≠ L296), S369 (= S297), G371 (= G299), L372 (≠ I300), D373 (= D301), S374 (= S302), L400 (≠ S325), R457 (= R384), T475 (= T402)
- binding nicotinic acid adenine dinucleotide: R355 (≠ Y283), L359 (≠ N287), V447 (≠ T374), N466 (= N393), G470 (≠ A397), E480 (= E407), W485 (≠ Y412), T487 (= T414), Y488 (≠ L415), D492 (= D418), H496 (≠ G422), F616 (≠ Y522), K617 (= K523)
3seqD Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with ampcpp and naad+ (see paper)
24% identity, 98% coverage: 6:545/552 of query aligns to 18:631/650 of 3seqD
- binding diphosphomethylphosphonic acid adenosyl ester: G367 (= G295), V368 (≠ L296), S369 (= S297), G371 (= G299), L372 (≠ I300), D373 (= D301), S374 (= S302), A399 (≠ P324), L400 (≠ S325), R447 (= R384), T465 (= T402)
- binding nicotinic acid adenine dinucleotide: R355 (≠ Y283), L359 (≠ N287), N456 (= N393), G460 (≠ A397), W475 (≠ Y412), S476 (≠ C413), T477 (= T414), Y478 (≠ L415), D482 (= D418), H486 (≠ G422), F605 (≠ Y522), K606 (= K523)
3sezC Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with atp and naad+ (see paper)
24% identity, 98% coverage: 6:545/552 of query aligns to 17:629/648 of 3sezC
- binding adenosine-5'-triphosphate: G366 (= G295), V367 (≠ L296), S368 (= S297), S373 (= S302), A398 (≠ P324), L399 (≠ S325), R445 (= R384), T463 (= T402)
- binding nicotinic acid adenine dinucleotide: L358 (≠ N287), N454 (= N393), G458 (≠ A397), E468 (= E407), W473 (≠ Y412), S474 (≠ C413), T475 (= T414), Y476 (≠ L415), D480 (= D418), H484 (≠ G422), F603 (≠ Y522), K604 (= K523)
3fiuA Structure of nmn synthetase from francisella tularensis (see paper)
29% identity, 43% coverage: 291:527/552 of query aligns to 26:233/238 of 3fiuA
- binding adenosine monophosphate: G30 (= G295), L31 (= L296), S32 (= S297), L56 (≠ M323), R113 (= R384), T131 (= T402), D147 (= D418), S182 (= S464)
- binding magnesium ion: D36 (= D301), E136 (= E407)
- binding pyrophosphate 2-: S32 (= S297), G34 (= G299), I35 (= I300), D36 (= D301), S37 (= S302), K160 (= K431), P181 (= P463), S182 (= S464)
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
27% identity, 42% coverage: 16:247/552 of query aligns to 17:259/297 of 5h8jB
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
27% identity, 42% coverage: 16:247/552 of query aligns to 21:263/301 of 5h8iC
- active site: E48 (= E43), N104 (= N103), K121 (= K119), E132 (= E130), C158 (= C155), A183 (≠ V177)
- binding (4-azanylbutylamino)methanediol: E48 (= E43), P125 (= P123), Y130 (≠ F128), C158 (= C155), W159 (≠ E156), A183 (≠ V177), E187 (≠ S181)
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
31% identity, 39% coverage: 20:235/552 of query aligns to 27:232/263 of 4iztA
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
31% identity, 39% coverage: 20:235/552 of query aligns to 19:224/254 of 4izuA
Sites not aligning to the query:
Query Sequence
>Ac3H11_517 FitnessBrowser__acidovorax_3H11:Ac3H11_517
MTLSICTAQLNFVVGDMPGNAQKIIAAAREAYAQGARLLLTPELAICGYAAEDLFLRPAF
IAACDDAVKTVARETAGLKGLAIVLGHPQALAPDAPAFSACHNAASVLRDGRIEQTYAKR
ELPNYQVFDERRYFVAGTAPCVFEVEGVRVGLLVCEDAWFAEPARSTAAAGAQLLAVINA
SPFHLGKSAEREATMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALNADGSVAGRAPGF
EEKLVFARVHHAQAAIKIEADIAPEKSLEADLWDALVLGVRDYVGKNGFPGALLGLSGGI
DSALVLAVAVDALGADKVRTVMMPSPYTADISWIDARDMAERLGVRYDEISIKPQFEAFK
AALASDFAGLAEDTTEENLQARIRGTLLMALSNKFGAIVLTTGNKSEMSTGYCTLYGDMA
GGFAVIKDVAKTRVFDLARWRNANDPYGTGANPIPERIITRPPSAELRPDQKDQDSLPPY
EVLDAIVARYMENDEPIESIIASGYARADVERVTRLIKLNEYKRRQAPVGIRVTRRSFGK
DWRYPITNKFRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory