Comparing Ac3H11_59 FitnessBrowser__acidovorax_3H11:Ac3H11_59 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
29% identity, 84% coverage: 25:291/319 of query aligns to 1:271/302 of 8hkbA
7ndrD Crystal structure of tphc in an open conformation (see paper)
25% identity, 87% coverage: 29:305/319 of query aligns to 5:280/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
25% identity, 87% coverage: 29:305/319 of query aligns to 5:280/294 of 7ndsA
2dvzA Structure of a periplasmic transporter (see paper)
26% identity, 89% coverage: 23:306/319 of query aligns to 1:285/300 of 2dvzA
2f5xB Structure of periplasmic binding protein bugd (see paper)
26% identity, 81% coverage: 29:287/319 of query aligns to 7:264/300 of 2f5xB
5okuA R. Palustris rpa4515 with adipate (see paper)
23% identity, 75% coverage: 29:268/319 of query aligns to 7:245/299 of 5okuA
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
23% identity, 75% coverage: 29:268/319 of query aligns to 7:245/299 of 5oeiA
>Ac3H11_59 FitnessBrowser__acidovorax_3H11:Ac3H11_59
MRRDTFLKSLAAMAAAGVLPVSAQTASAIKMMIPANPGGGWDTTGRALGKAMQDAGAAAS
VSYDNKGGAAGAIGLAQFVNASKGDANAMMVMGAVMLGGIITGKPPVGLDKVTPLARLTS
EYNVFVLPANSPFKTMKDVIDQLKKDPGSVKWGGGSRGSTEHIAAAMIAREVGVDPAKIN
YVAFRGGGEATAAILGGNVTVGGSGYSEFAEYITAGKMRPVGVTSGTRLKGVNVPTLKEQ
GINVEIGNWRGVYGAPGITPEQRKTLIDALTKTYKHKAWQDAMEKNGWTPAWMAGDEFAN
FVDSEFASMRATMAKSGMI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory