Comparing Ac3H11_603 FitnessBrowser__acidovorax_3H11:Ac3H11_603 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q1JUQ0 L-2-keto-3-deoxyarabonate dehydratase; L-KDA dehydratase; 2-dehydro-3-deoxy-L-arabinonate dehydratase; L-2-keto-3-deoxyarabinonate dehydratase; EC 4.2.1.43 from Azospirillum brasilense (see paper)
81% identity, 100% coverage: 1:293/294 of query aligns to 16:308/309 of Q1JUQ0
Sites not aligning to the query:
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
31% identity, 96% coverage: 3:285/294 of query aligns to 12:290/291 of 3na8A
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
31% identity, 79% coverage: 1:233/294 of query aligns to 10:242/298 of 4ptnA
Sites not aligning to the query:
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
31% identity, 79% coverage: 1:233/294 of query aligns to 10:242/298 of 4onvA
Sites not aligning to the query:
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
31% identity, 79% coverage: 1:233/294 of query aligns to 10:242/298 of 4oe7D
Sites not aligning to the query:
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
31% identity, 79% coverage: 1:233/294 of query aligns to 10:242/298 of 4oe7B
Sites not aligning to the query:
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
31% identity, 79% coverage: 1:233/294 of query aligns to 10:242/298 of 4oe7A
Sites not aligning to the query:
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
31% identity, 79% coverage: 1:233/294 of query aligns to 10:242/298 of 3nevA
Sites not aligning to the query:
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
27% identity, 92% coverage: 3:273/294 of query aligns to 16:279/295 of 3l21B
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
27% identity, 92% coverage: 3:273/294 of query aligns to 21:284/300 of P9WP25
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
27% identity, 92% coverage: 3:273/294 of query aligns to 17:280/296 of 1xxxA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
27% identity, 92% coverage: 3:273/294 of query aligns to 18:281/297 of 5j5dA
Sites not aligning to the query:
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
24% identity, 94% coverage: 4:279/294 of query aligns to 11:274/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
24% identity, 94% coverage: 4:279/294 of query aligns to 12:275/295 of 1o5kA
3qfeA Crystal structures of a putative dihydrodipicolinate synthase family protein from coccidioides immitis
27% identity, 76% coverage: 10:231/294 of query aligns to 24:239/305 of 3qfeA
Sites not aligning to the query:
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
23% identity, 97% coverage: 1:285/294 of query aligns to 9:268/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
23% identity, 97% coverage: 1:285/294 of query aligns to 9:268/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
23% identity, 97% coverage: 1:285/294 of query aligns to 9:268/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
23% identity, 97% coverage: 1:285/294 of query aligns to 9:268/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
23% identity, 97% coverage: 1:285/294 of query aligns to 9:268/291 of 3rk8A
>Ac3H11_603 FitnessBrowser__acidovorax_3H11:Ac3H11_603
VPTTFHEDGTLDLDSQKRCLDFMIDAGVDGVCILANFSEQFSLSDAEREVLTRTSLEHVA
GRVPVIVTTTHYGTRVCAERSRAAQDMGAAMVMVMPPYHGATFRVPEAQIYEFYARVSDA
IRIPIMVQDAPASGTVLSAPFLARMAQEIENLAYFKIEVPGAASKLRELIRLGGDAIEGP
WDGEEAITLLADLDAGATGAMTGGAFPDGIRPIIEAHRQGDMDQAFALYQRWLPLINHEN
RQGGILTAKALMKEGGVIACEAGRHPFPAMHPEVRRGLVDIARRLDPLVLRWAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory