SitesBLAST
Comparing Ac3H11_607 FitnessBrowser__acidovorax_3H11:Ac3H11_607 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
38% identity, 93% coverage: 18:499/517 of query aligns to 4:477/501 of P04983
- K43 (= K57) mutation to R: Loss of transport.
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 43% coverage: 17:239/517 of query aligns to 1:217/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 44% coverage: 21:245/517 of query aligns to 4:223/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (= F28), V16 (= V33), S36 (≠ N53), G37 (= G54), S38 (≠ A55), G39 (= G56), K40 (= K57), S41 (= S58), T42 (= T59), E162 (= E184), H194 (= H216)
- binding magnesium ion: S41 (= S58), E162 (= E184)
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 44% coverage: 19:245/517 of query aligns to 1:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 44% coverage: 19:245/517 of query aligns to 1:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 44% coverage: 19:245/517 of query aligns to 1:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 44% coverage: 19:245/517 of query aligns to 1:225/242 of 2oljA
7o12B Abc transporter nosdfy, amppnp-bound in gdn (see paper)
34% identity, 42% coverage: 19:235/517 of query aligns to 3:204/298 of 7o12B
7o17B Abc transporter nosdfy e154q, atp-bound in lipid nanodisc (see paper)
34% identity, 42% coverage: 19:235/517 of query aligns to 3:204/298 of 7o17B
- binding adenosine-5'-triphosphate: Y12 (≠ F28), V17 (= V33), N37 (= N53), G38 (= G54), A39 (= A55), G40 (= G56), K41 (= K57), T42 (≠ S58), T43 (= T59), E80 (≠ Q100), R123 (= R154), T127 (≠ D158), S129 (≠ P160), K130 (≠ V161), G131 (≠ A162), M132 (≠ V163)
- binding magnesium ion: K41 (= K57), T42 (≠ S58)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 42% coverage: 16:234/517 of query aligns to 15:224/378 of P69874
- C26 (≠ Q27) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F28) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ I46) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ A55) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ I61) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L77) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ I146) mutation to M: Loss of ATPase activity and transport.
- D172 (= D183) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 40% coverage: 31:239/517 of query aligns to 20:223/615 of 5lilA
- binding adenosine-5'-triphosphate: V22 (= V33), S42 (≠ N53), G43 (= G54), G45 (= G56), K46 (= K57), S47 (= S58), T48 (= T59), Q92 (= Q100), K136 (≠ D151), Q143 (≠ D158), S145 (≠ P160), G147 (≠ A162), Q148 (≠ V163)
- binding magnesium ion: S47 (= S58), Q92 (= Q100)
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
31% identity, 40% coverage: 31:239/517 of query aligns to 20:223/592 of 5lj7A
- binding adenosine-5'-triphosphate: V22 (= V33), S42 (≠ N53), G43 (= G54), G45 (= G56), K46 (= K57), S47 (= S58), T48 (= T59), Q92 (= Q100), K136 (≠ D151), Q143 (≠ D158), S145 (≠ P160), G147 (≠ A162), Q148 (≠ V163)
- binding magnesium ion: S47 (= S58), Q92 (= Q100)
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
30% identity, 43% coverage: 18:237/517 of query aligns to 3:218/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
30% identity, 43% coverage: 18:237/517 of query aligns to 3:218/230 of 6z4wA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 43% coverage: 16:237/517 of query aligns to 2:222/648 of P75831
- K47 (= K57) mutation to L: Lack of activity.
- D169 (= D183) mutation to N: Lack of activity.
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
28% identity, 44% coverage: 18:245/517 of query aligns to 6:226/240 of 1ji0A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 42% coverage: 19:234/517 of query aligns to 4:210/369 of P19566
- L86 (= L104) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P185) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D190) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
Q99758 Phospholipid-transporting ATPase ABCA3; ABC-C transporter; ATP-binding cassette sub-family A member 3; ATP-binding cassette transporter 3; ATP-binding cassette 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Homo sapiens (Human) (see 15 papers)
32% identity, 39% coverage: 34:234/517 of query aligns to 549:739/1704 of Q99758
- N568 (= N53) to D: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; does not affect protein expression; does not affect multivesicular bodies and lamellar bodies location; affects multivesicular bodies and lamellar bodies development; loss of phosphatidylcholine transport; does not affect cholesterol transport; dbSNP:rs121909184
- L579 (= L64) to P: in SMDP3; uncertain significance
- R605 (≠ A90) to Q: in SMDP3; uncertain significance; dbSNP:rs760006956
- S693 (= S187) mutation to L: Does not affect protein oligomerization.
Sites not aligning to the query:
- 43 R → L: in SMDP3; uncertain significance
- 53 N→Q: Does not affect N-glycosylation. Does not affect protein expression. Does not affect lamellar body membrane location.
- 101 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; dbSNP:rs121909182
- 124 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-140. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 140 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N → H: in dbSNP:rs45447801; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-124. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 173:174 LK→AA: Loss of proteolytic processing.
- 174:175 Cleavage; by CTSL
- 215 Q → K: in SMDP3; loss of lamellar bodies membrane location; loss of proteolytic cleavage; increases cellular free cholesterol and phosphatidylcholine transport; loss of vesicles formation; increases free cholesterol induced cell death; loss of protein oligomerization; dbSNP:rs879159551
- 280 R → C: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs201299260
- 288 R → K: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs117603931
- 290 L → M: in a breast cancer sample; somatic mutation
- 292 E → V: in SMDP3; uncertain significance; does not affect lamellar bodies membrane location; does not affect proteolytic cleavage; affects lamellar bodies formation; does not affect cholesterol and phosphatidylcholine transport; decreases vesicles formation; does not affect free cholesterol induced cell death; dbSNP:rs149989682
- 766 P → S: in dbSNP:rs45592239
- 801 E → D: in a breast cancer sample; somatic mutation
- 945 N→Q: Does not affect lamellar body membrane location. Does not affect protein expression. Does not affect proteolytic processing.
- 982 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs1402761450
- 1069 H → Q: in a breast cancer sample; somatic mutation
- 1076 N → K: in SMDP3; uncertain significance
- 1221 G → S: in SMDP3; does not affect intracellular vesicle membrane location; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; G→A: Decreases ATP hydrolysis activity of 15% compared to the wild-type.; G→T: Decreases ATP hydrolysis activity of 36% compared to the wild-type.; G→V: Decreases ATP hydrolysis activity of 18% compared to the wild-type.
- 1302 G → E: in SMDP3; uncertain significance
- 1388 K → N: in SMDP3; decreases phosphatidylcholine transport; increases protein abundance; does not affect folding in the endoplasmic reticulum; decreases proteolytic processing; affects lamellar bodies development; reduces free cholesterol transport
- 1553 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs121909183
- 1580 L → P: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; affects the intracellular vesicles development; decreases phosphatidylcholine transport; L→A: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→F: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→V: Decreases ATP hydrolysis activity of 56% compared to the wild-type.
- 1591 Q → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs28936691
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
31% identity, 42% coverage: 19:234/517 of query aligns to 3:209/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
31% identity, 42% coverage: 19:234/517 of query aligns to 1:207/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F28), S35 (≠ N53), G36 (= G54), C37 (≠ A55), G38 (= G56), K39 (= K57), S40 (= S58), T41 (= T59), R126 (≠ D158), A130 (= A162), S132 (vs. gap), G134 (vs. gap), Q135 (vs. gap)
Query Sequence
>Ac3H11_607 FitnessBrowser__acidovorax_3H11:Ac3H11_607
MTVSMDASTAHAPAAAPVLQLSGIHKQFAGITVLRDVQLNLYPGEIHALMGQNGAGKSTL
IKVLTGVLEASGGQMRLGGQAVWPDSPLAAQRLGISTVYQEVNLCPNLSVAENIFAGRYP
RCGIAQGFRIDWATLHQRARDLVARIGLQIDVTRLLSDYPVAVQQLVAIARALSIESRVL
ILDEPTSSLDDDEVQKLFEVLRRLRSEGLSIVFVTHFLNQVYAVSDRITVLRNGSWVGEW
LAKDLGPQALIAAMLGRDLAAASEQPAPAPAVDSRHANLLQAEGLGQDTQLQPLDLQIRA
GEVVGLAGLLGSGRTELARLLFGLEQPDRGALRIDGQVVKFANPMDAIRHGLALCPEERK
TDGIVAELSVRENIALALQARMGVGKFLSRSEQTELAERYVKLLGIKTETVDKPIGLLSG
GNQQKAILARWMAIEPRLLILDEPTRGIDVAAKQEIMDQILRLAQAGMAVLFISSEMSEV
VRVAHRIVVLRDRRKVGELPAGSSEDAVYDLIAAEHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory